Result : O35041
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YfjT |
| NCBI Accession ID | D83967.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1777 |
| Right | 1962 |
| Strand | - |
| Nucleotide Sequence | ATGGGGAACGCCGTAAACAATAAAGATCAGCAGATTGATTATTTAAAGAACAGACTTGACATGTTTATGAACGTCATCGATTCATTAGACCCTGAAGCAACCGACGTTGAAGATATAGACAGGCTTATCAGCATGCTTGATGACCTGGAAGCCAAATACGAACGTTTTAAAAAAGATTGGGAATAA |
| Sequence | MGNAVNNKDQQIDYLKNRLDMFMNVIDSLDPEATDVEDIDRLISMLDDLEAKYERFKKDWE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8969503 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O35041 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 50
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 803203 | 803388 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 2 | 846108 | 846293 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 869273 | 869458 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 846671 | 846856 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1057199 | 1057384 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 867824 | 868009 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1135671 | 1135856 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 807462 | 807647 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3145088 | 3145273 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 846086 | 846271 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 929003 | 929188 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 899048 | 899233 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 832737 | 832928 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 784616 | 784807 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 711931 | 712122 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 308418 | 308600 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 17 | 3638492 | 3638698 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 18 | 331308 | 331502 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 19 | 823642 | 823824 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 20 | 812127 | 812312 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 21 | 374997 | 375182 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 22 | 3388043 | 3388219 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 23 | 573866 | 574054 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 24 | 1135012 | 1135200 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 25 | 3330644 | 3330829 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 26 | 4647457 | 4647639 | - | NZ_CP040336.1 | Bacillus luti |
| 27 | 442195 | 442377 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 28 | 474059 | 474241 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 29 | 473357 | 473539 | + | NC_011725.1 | Bacillus cereus B4264 |
| 30 | 463063 | 463245 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 31 | 457010 | 457189 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 32 | 3075111 | 3075299 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 33 | 1978162 | 1978347 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 34 | 1007243 | 1007440 | - | NZ_CP059540.1 | Planococcus maritimus |
| 35 | 995799 | 995996 | - | NZ_CP016538.2 | Planococcus maritimus |
| 36 | 466351 | 466542 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 37 | 1019308 | 1019505 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 38 | 734377 | 734574 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 39 | 4009643 | 4009828 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 40 | 724425 | 724610 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 41 | 1500688 | 1500885 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 42 | 959277 | 959468 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 43 | 683139 | 683324 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 44 | 928693 | 928887 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 45 | 770264 | 770458 | + | NZ_CP013661.2 | Planococcus kocurii |
| 46 | 999249 | 999443 | - | NZ_CP019401.1 | Planococcus faecalis |
| 47 | 2192998 | 2193183 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 48 | 740253 | 740435 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 49 | 1056179 | 1056373 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 50 | 780426 | 780611 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 51 | 979813 | 979998 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14167.8 | 0.64 | 32 | 1478.0 | same-strand | YfkD-like protein |
| 2 | PF08756.12 | 0.72 | 36 | 146.5 | opposite-strand | YfkB-like domain |
| 3 | PF04055.23 | 0.72 | 36 | 146.5 | opposite-strand | Radical SAM superfamily |
| 4 | PF01522.23 | 0.7 | 35 | 1765 | same-strand | Polysaccharide deacetylase |
++ More..