Result : O35036
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YfkS |
| NCBI Accession ID | D86417.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4353 |
| Right | 4553 |
| Strand | + |
| Nucleotide Sequence | ATGATCAGCTATATCGTACAGACATTGATTGTGTGCATTGCCATATACGCATATGAATGGAAGAATTTTCGTTCCGCTAACAATCTAACAAAATGGGCCTTCAGCCTGCTAATTGCAGGAAGTGCTTTTCTATGGATTTATATGAGAGTGAATCCCCTGCTTCCGCGGCTGGGGCACCTGTTTAAATATATTCCGTTTTGA |
| Sequence | MISYIVQTLIVCIAIYAYEWKNFRSANNLTKWAFSLLIAGSAFLWIYMRVNPLLPRLGHLFKYIPF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9272861 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O35036 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 847282 | 847482 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 781207 | 781407 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 823987 | 824187 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1036863 | 1037063 | - | NZ_CP033052.1 | Bacillus vallismortis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02378.20 | 0.75 | 3 | 4078.0 | opposite-strand | Phosphotransferase system, EIIC |
| 2 | PF00367.22 | 0.75 | 3 | 4078.0 | opposite-strand | phosphotransferase system, EIIB |
| 3 | PF00884.25 | 1.0 | 4 | 3287.5 | same-strand | Sulfatase |
| 4 | PF09350.12 | 1.0 | 4 | 2637.0 | opposite-strand | Domain of unknown function (DUF1992) |
| 5 | PF01235.19 | 1.0 | 4 | 1097.0 | opposite-strand | Sodium:alanine symporter family |
| 6 | PF03845.15 | 1.0 | 4 | 24.0 | same-strand | Spore germination protein |
| 7 | PF05504.13 | 1.0 | 4 | 16.0 | same-strand | Spore germination B3/ GerAC like, C-terminal |
| 8 | PF03323.15 | 1.0 | 4 | 1151.0 | same-strand | Bacillus/Clostridium GerA spore germination protein |
| 9 | PF00128.26 | 0.75 | 3 | 4370 | opposite-strand | Alpha amylase, catalytic domain |
| 10 | PF16657.7 | 0.75 | 3 | 4370 | opposite-strand | Maltogenic Amylase, C-terminal domain |
| 11 | PF07702.15 | 0.75 | 3 | 6079 | opposite-strand | UTRA domain |
| 12 | PF00392.23 | 0.75 | 3 | 6079 | opposite-strand | Bacterial regulatory proteins, gntR family |
++ More..