Result : O35031
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | D86417.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13824 |
| Right | 14099 |
| Strand | + |
| Nucleotide Sequence | ATGCTTCAATACCGAATCATTGTAGACGGCCGGGTTCAAGGTGTGGGCTTTCGCTATTTTGTTCAAATGGAAGCTGATAAGCGAAAACTGGCCGGCTGGGTCAAAAACCGTGATGACGGGCGTGTCGAGATTTTGGCAGAGGGTCCGGAAAACGCCCTGCAATCGTTTGTTGAGGCTGTAAAGAACGGAAGCCCTTTCTCAAAGGTTACCGACATCTCTGTGACTGAATCCCGCAGCCTTGAAGGCCATCATCGATTTTCTATTGTTTACTCATAA |
| Sequence | MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 9272861 9384377 20447399 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | O35031 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 837735 | 838010 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 771641 | 771916 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 818363 | 818638 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 814419 | 814694 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1026007 | 1026282 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1165001 | 1165276 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 839717 | 839992 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 880755 | 881027 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 846237 | 846548 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 10 | 774834 | 775106 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 11 | 3177624 | 3177896 | + | NZ_CP011937.1 | Bacillus velezensis |
| 12 | 799713 | 799985 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 3655230 | 3655502 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 14 | 3592760 | 3593032 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 15 | 87123 | 87395 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 16 | 2787544 | 2787822 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 17 | 746702 | 746974 | + | NZ_CP043404.1 | Bacillus safensis |
| 18 | 867022 | 867294 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 19 | 3145574 | 3145825 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 20 | 455690 | 455941 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 21 | 3487783 | 3488034 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 22 | 1811034 | 1811285 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 23 | 1262246 | 1262518 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 24 | 264597 | 264866 | + | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 25 | 3763248 | 3763538 | + | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 26 | 2764899 | 2765168 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 27 | 2403959 | 2404231 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 28 | 1515291 | 1515560 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 29 | 1041321 | 1041548 | + | NZ_CP045927.1 | Staphylococcus agnetis |
++ More..