Result : A3DE79
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | CP000568.1 |
| Organism | Hungateiclostridium thermocellum (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) (Clostridium thermocellum) |
| Left | 1228639 |
| Right | 1228839 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAACCCAAAGCGTAAATGGTCTAAAGCCAGAACAGGCAAAAGAAGGTCTCAGTGGAAGTTAACAGTACCCAACTTGGTTGAATGTCCGCATTGCCACTCATTGAAGCTGCTCCACAGAGTATGCAAAGAGTGCGGGCATTATACGGTAAGGCATAAAGGTGAGCGCAAGTCAATTGAGGTTCTCAGCGTAGAATAG |
| Sequence | MANPKRKWSKARTGKRRSQWKLTVPNLVECPHCHSLKLLHRVCKECGHYTVRHKGERKSIEVLSVE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A3DE79 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 93
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1415099 | 1415299 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 2 | 2367929 | 2368129 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 3 | 3105720 | 3105902 | - | NZ_CP014176.1 | Clostridium argentinense |
| 4 | 1300986 | 1301162 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 5 | 2915979 | 2916164 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 6 | 1894745 | 1894927 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 7 | 2279729 | 2279911 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 8 | 1483349 | 1483537 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 9 | 1424987 | 1425175 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 10 | 430308 | 430487 | - | NZ_CP023643.1 | Brochothrix thermosphacta |
| 11 | 1364049 | 1364225 | - | NZ_LR778174.1 | Veillonella parvula |
| 12 | 797570 | 797746 | + | NZ_LT906470.1 | Veillonella rodentium |
| 13 | 3571920 | 3572093 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 14 | 1252230 | 1252406 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 15 | 1305974 | 1306150 | - | NZ_LR134375.1 | Veillonella dispar |
| 16 | 2750372 | 2750545 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 17 | 1411660 | 1411833 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 18 | 1801238 | 1801432 | - | NZ_LS483423.1 | Jonesia denitrificans |
| 19 | 3957482 | 3957658 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 20 | 655988 | 656170 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 21 | 875114 | 875293 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 22 | 1714420 | 1714614 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 23 | 5663143 | 5663316 | + | NZ_CP023703.1 | Streptomyces galilaeus |
| 24 | 1716330 | 1716509 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 25 | 1124011 | 1124193 | - | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 26 | 1127728 | 1127907 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 27 | 1306224 | 1306418 | + | NC_013521.1 | Sanguibacter keddieii DSM 10542 |
| 28 | 2387853 | 2388038 | - | NZ_CP011502.1 | Aeromicrobium erythreum |
| 29 | 220255 | 220428 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 30 | 2855137 | 2855310 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 31 | 569247 | 569420 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 32 | 1421752 | 1421934 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 33 | 1498647 | 1498829 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 34 | 1124474 | 1124647 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 35 | 4815945 | 4816118 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 36 | 2250311 | 2250505 | - | NC_015588.1 | Isoptericola variabilis 225 |
| 37 | 1975664 | 1975837 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 38 | 3006390 | 3006563 | - | NC_013929.1 | Streptomyces scabiei 87.22 |
| 39 | 2876513 | 2876686 | - | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 40 | 3240961 | 3241155 | - | NZ_CP041694.1 | Cellulosimicrobium cellulans |
| 41 | 5592897 | 5593070 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 42 | 2564090 | 2564263 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 43 | 6700187 | 6700360 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 44 | 2724768 | 2724941 | - | NZ_CP034687.1 | Streptomyces griseoviridis |
| 45 | 5835361 | 5835534 | + | NZ_CP031194.1 | Streptomyces paludis |
| 46 | 2757440 | 2757613 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 47 | 3057503 | 3057676 | - | NZ_CP023689.1 | Streptomyces chartreusis |
| 48 | 7648185 | 7648358 | + | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 49 | 3720902 | 3721084 | - | NZ_CP061799.1 | Desulfonema limicola |
| 50 | 2946811 | 2946984 | - | NZ_CP022744.1 | Streptomyces lincolnensis |
| 51 | 2211206 | 2211379 | - | NZ_CP060404.1 | Streptomyces buecherae |
| 52 | 2623893 | 2624084 | - | NZ_CP045529.1 | Luteimicrobium xylanilyticum |
| 53 | 1870819 | 1870995 | + | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 54 | 1916199 | 1916381 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 55 | 9086164 | 9086337 | + | NZ_AP022870.1 | Phytohabitans flavus |
| 56 | 5376461 | 5376634 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 57 | 5854056 | 5854229 | + | NZ_CP063374.1 | Streptomyces chromofuscus |
| 58 | 1943776 | 1943949 | + | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 59 | 7193383 | 7193556 | + | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 60 | 6239348 | 6239521 | + | NZ_CP023691.1 | Streptomyces platensis |
| 61 | 2963171 | 2963344 | - | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 62 | 6028677 | 6028850 | + | NC_021985.1 | Streptomyces collinus Tu 365 |
| 63 | 2802528 | 2802701 | - | NZ_CP051006.1 | Streptomyces griseofuscus |
| 64 | 5455748 | 5455921 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 65 | 5539390 | 5539563 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 66 | 6000023 | 6000196 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 67 | 6277403 | 6277576 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 68 | 7931256 | 7931429 | - | NZ_CP063373.1 | Streptomyces ferrugineus |
| 69 | 5657172 | 5657345 | + | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 70 | 5380131 | 5380304 | + | NZ_CP029043.1 | Streptomyces nigra |
| 71 | 6366690 | 6366863 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 72 | 3258473 | 3258646 | - | NZ_CP017248.1 | Streptomyces fodineus |
| 73 | 5744941 | 5745114 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 74 | 1672606 | 1672791 | - | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 75 | 1362718 | 1362906 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 76 | 5396817 | 5396990 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 77 | 6137141 | 6137314 | + | NZ_CP071839.1 | Streptomyces cyanogenus |
| 78 | 7380065 | 7380238 | + | NZ_CP034463.1 | Streptomyces aquilus |
| 79 | 7597465 | 7597638 | + | NZ_CP065050.1 | Streptomyces solisilvae |
| 80 | 4538435 | 4538608 | - | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 81 | 6049168 | 6049341 | + | NZ_CP019457.1 | Streptomyces lydicus |
| 82 | 2578603 | 2578776 | - | NZ_CP023698.1 | Streptomyces viridifaciens |
| 83 | 1099545 | 1099730 | + | NZ_CP049257.1 | Nocardioides anomalus |
| 84 | 2131949 | 2132131 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 85 | 7924476 | 7924658 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 86 | 9247505 | 9247684 | - | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 87 | 2605547 | 2605738 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 88 | 1018288 | 1018467 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 89 | 1298886 | 1299074 | + | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 90 | 1375769 | 1375948 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 91 | 6051119 | 6051301 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 92 | 2510308 | 2510490 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 93 | 2068480 | 2068659 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_013510.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02620.19 | 0.97 | 90 | 3.0 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 2 | PF14622.8 | 0.69 | 64 | 20.0 | same-strand | Ribonuclease-III-like |
| 3 | PF00636.28 | 0.71 | 66 | 20.0 | same-strand | Ribonuclease III domain |
| 4 | PF00035.28 | 0.7 | 65 | 20 | same-strand | Double-stranded RNA binding motif |
| 5 | PF01467.28 | 0.69 | 64 | 1971.5 | same-strand | Cytidylyltransferase-like |
| 6 | PF03602.17 | 0.62 | 58 | 2496.0 | same-strand | Conserved hypothetical protein 95 |
| 7 | PF01149.26 | 0.6 | 56 | 954.5 | same-strand | Formamidopyrimidine-DNA glycosylase N-terminal domain |
| 8 | PF06831.16 | 0.61 | 57 | 953 | same-strand | Formamidopyrimidine-DNA glycosylase H2TH domain |
++ More..