Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YlbE |
NCBI Accession ID | Z98682.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 13196 |
Right | 13435 |
Strand | + |
Nucleotide Sequence | ATGCGCAAAGAGGTTCAGGAATATATTTTAGCAAACGAAGAACGGAAACGATTCATCAGAGAACAGCCGATATGGTACCGCAGGCTTTCAAGAAAACCGGATGATCTGTCCTCCTTTCAGCTTGAAATGATGAATTTTTATGAAAAAACCATTCCGCATCGGGTGAATCAGTTTACGAACGGGATTCAAATGGCGCAAATGATGATGCAAATGTTTCAAGCGATGCGGACAAAAGATTAA |
Sequence | MRKEVQEYILANEERKRFIREQPIWYRRLSRKPDDLSSFQLEMMNFYEKTIPHRVNQFTNGIQMAQMMMQMFQAMRTKD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14003. Profile Description: YlbE-like protein. The YlbE-like protein family includes the B. subtilis protein YlbE, which is functionally uncharacterized. This family of cytosolic proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length. There is a conserved WYR sequence motif. |
Pubmed ID | 9384377 |
Domain | CDD:404822 |
Functional Category | Others |
Uniprot ID | O34958 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1568065 | 1568304 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1744823 | 1745062 | + | NZ_CP033052.1 | Bacillus vallismortis |
3 | 1540927 | 1541166 | + | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 1534591 | 1534830 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 1693000 | 1693239 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
6 | 1695058 | 1695297 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
7 | 1672417 | 1672656 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
8 | 1572119 | 1572358 | + | NZ_CP051464.1 | Bacillus mojavensis |
9 | 1475474 | 1475713 | + | NZ_CP048852.1 | Bacillus tequilensis |
10 | 419175 | 419414 | - | NZ_CP029364.1 | Bacillus halotolerans |
11 | 2436821 | 2437060 | - | NZ_CP011937.1 | Bacillus velezensis |
12 | 1524082 | 1524321 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
13 | 66448 | 66696 | - | NZ_CP043404.1 | Bacillus safensis |
14 | 233310 | 233558 | - | NZ_CP017786.1 | Bacillus xiamenensis |
15 | 1465932 | 1466180 | + | NZ_CP011150.1 | Bacillus altitudinis |
16 | 2484121 | 2484360 | - | NZ_CP016020.1 | Bacillus weihaiensis |
17 | 1950982 | 1951221 | + | NZ_CP042593.1 | Bacillus dafuensis |
18 | 1355974 | 1356216 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
19 | 2050977 | 2051216 | + | NZ_CP053989.1 | Niallia circulans |
20 | 2669635 | 2669874 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
21 | 4087024 | 4087260 | - | NZ_CP024035.1 | Priestia aryabhattai |
22 | 514208 | 514441 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
23 | 2881792 | 2882025 | - | NZ_CP070511.1 | Parageobacillus toebii |
24 | 2251611 | 2251844 | - | NZ_CP014342.1 | Geobacillus subterraneus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00571.30 | 0.79 | 19 | 1770 | same-strand | CBS domain |
2 | PF14504.8 | 0.88 | 21 | 599 | same-strand | CAP-associated N-terminal |
3 | PF00188.28 | 0.92 | 22 | 614 | same-strand | Cysteine-rich secretory protein family |
4 | PF14071.8 | 1.0 | 24 | 16.0 | same-strand | Putative coat protein |
5 | PF06133.13 | 1.0 | 24 | 403.0 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
6 | PF09902.11 | 0.96 | 23 | 1004 | same-strand | Uncharacterized protein conserved in bacteria (DUF2129) |
7 | PF03602.17 | 0.83 | 20 | 1352.0 | same-strand | Conserved hypothetical protein 95 |
8 | PF01467.28 | 0.67 | 16 | 1787.0 | same-strand | Cytidylyltransferase-like |