Result : O34937
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YopU |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2203111 |
| Right | 2203308 |
| Strand | - |
| Nucleotide Sequence | TTGAATATATTTGTTGATCAAGATAATTACAAAGAGGTTAGTCTGAAACTTACAAAAAAATTGCTGACTTCAGAACATTATCAATTCCTACTTTGTTTCAAGGGAGAGAAATTAGATATTACAATTTCAGTTACACCACAAAGCCTCGTTAAGCTTAGGGATGACATCAATGAATTGATCTTTATGTTCTCAGATTAA |
| Sequence | MNIFVDQDNYKEVSLKLTKKLLTSEHYQFLLCFKGEKLDITISVTPQSLVKLRDDINELIFMFSD |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34937 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2203111 | 2203308 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1795948 | 1796145 | + | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09643.12 | 1.0 | 2 | 701.0 | same-strand | YopX protein |
| 2 | PF09467.12 | 1.0 | 2 | 70.0 | same-strand | Hypothetical protein Yopt |
| 3 | PF13443.8 | 1.0 | 2 | 470.5 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
| 4 | PF01381.24 | 1.0 | 2 | 470.5 | opposite-strand | Helix-turn-helix |
| 5 | PF14072.8 | 1.0 | 2 | 1884.5 | same-strand | DNA-sulfur modification-associated |
| 6 | PF00589.24 | 1.0 | 2 | 3373.5 | same-strand | Phage integrase family |
++ More..