Result : O34923
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1397938 |
| Right | 1398093 |
| Strand | + |
| Nucleotide Sequence | ATGGAGGAAGAAAAAGCAGTCTCACTGGCAAAAGAAATTATAGAGTTGGATATCAAGCGTGATGAAATGCTGGAGACGTTTATGCAGCTTGCCGGAGAACAGGCTTTTCAATTATTAAGATCGGTTCAAAACGGACAATACCGAAAATCTTCGTAA |
| Sequence | MEEEKAVSLAKEIIELDIKRDEMLETFMQLAGEQAFQLLRSVQNGQYRKSS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34923 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1397938 | 1398093 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1373066 | 1373221 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1369436 | 1369591 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1309928 | 1310083 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 586153 | 586308 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1408360 | 1408515 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1580255 | 1580416 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 1320420 | 1320575 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2640127 | 2640282 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1443162 | 1443317 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1526037 | 1526192 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1464978 | 1465133 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 1310021 | 1310176 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 387455 | 387586 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 235644 | 235775 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3386197 | 3386334 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 17 | 2769195 | 2769335 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 18 | 1910608 | 1910751 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 19 | 3969660 | 3969797 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 20 | 2378878 | 2379015 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 21 | 2370825 | 2370962 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 22 | 1257480 | 1257617 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 23 | 2833271 | 2833405 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 24 | 1463503 | 1463637 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 25 | 1091506 | 1091643 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 26 | 1888098 | 1888235 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 27 | 2069842 | 2069979 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 28 | 1371505 | 1371642 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13411.8 | 0.93 | 26 | 196.0 | opposite-strand | MerR HTH family regulatory protein |
| 2 | PF00376.25 | 0.93 | 26 | 196.0 | opposite-strand | MerR family regulatory protein |
| 3 | PF13076.8 | 0.61 | 17 | 88 | same-strand | Fur-regulated basic protein A |
| 4 | PF01047.24 | 0.64 | 18 | 417.0 | same-strand | MarR family |
| 5 | PF13463.8 | 0.64 | 18 | 417.0 | same-strand | Winged helix DNA-binding domain |
| 6 | PF12802.9 | 0.64 | 18 | 417.0 | same-strand | MarR family |
++ More..