| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YtpI |
| NCBI Accession ID | AF008220.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 181842 |
| Right | 182144 |
| Strand | - |
| Nucleotide Sequence | ATGCTGGTTCTTGTTTTTTTGATTGGGCTTTCAGCCTGCTTTTATGTGTACTATAAAGTAAAAGGCGTACGGGCAAAGCCATCTTTGGCAAAAGAAATATGTTCAGCAAAATCAAGCATGGCCTTAGGGTCACTAGTCCTGTTCTACGGGCTTAACCAAATGATATTATTCCATTCAGTATTAACGTTAGTAATCGGCGGTATCTTTATCGTCATAGGAGCAGGAAGCGCTTGGGCAGGTTATAAAGCCTTCAGGCATTACAATCCCCTTCACGCCAAAGAAGCTGAAAGAGATCACGCGTAA |
| Sequence | MLVLVFLIGLSACFYVYYKVKGVRAKPSLAKEICSAKSSMALGSLVLFYGLNQMILFHSVLTLVIGGIFIVIGAGSAWAGYKAFRHYNPLHAKEAERDHA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14007. Profile Description: YtpI-like protein. The YtpI-like protein family includes the B. subtilis YtpI protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 73 and 101 amino acids in length. |
| Pubmed ID | 9387221 9384377 |
| Domain | CDD:379413 |
| Functional Category | Others |
| Uniprot ID | O34922 |
| ORF Length (Amino Acid) | 100 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2996980 | 2997282 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2810111 | 2810413 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 2880130 | 2880432 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 2875948 | 2876250 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3297127 | 3297429 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2802365 | 2802667 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2814142 | 2814444 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 1150202 | 1150504 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2836231 | 2836533 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2780368 | 2780670 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 2688109 | 2688411 | - | NZ_CP043404.1 | Bacillus safensis |
| 12 | 2612480 | 2612782 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 3339442 | 3339744 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 2964939 | 2965241 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 93556 | 93867 | + | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 16 | 3152124 | 3152426 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 17 | 1178397 | 1178708 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 18 | 3692841 | 3693152 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07733.14 | 1.0 | 18 | 2364.5 | opposite-strand | Bacterial DNA polymerase III alpha NTPase domain |
| 2 | PF17657.3 | 1.0 | 18 | 2364.5 | opposite-strand | Bacterial DNA polymerase III alpha subunit finger domain |
| 3 | PF02811.21 | 1.0 | 18 | 2364.5 | opposite-strand | PHP domain |
| 4 | PF14579.8 | 1.0 | 18 | 2364.5 | opposite-strand | Helix-hairpin-helix motif |
| 5 | PF01336.27 | 1.0 | 18 | 2364.5 | opposite-strand | OB-fold nucleic acid binding domain |
| 6 | PF14034.8 | 1.0 | 18 | 1884.5 | same-strand | Sporulation protein YtrH |
| 7 | PF02272.21 | 1.0 | 18 | 131.0 | opposite-strand | DHHA1 domain |
| 8 | PF01368.22 | 1.0 | 18 | 131.0 | opposite-strand | DHH family |
| 9 | PF07085.14 | 1.0 | 18 | 24.0 | opposite-strand | DRTGG domain |
| 10 | PF00571.30 | 1.0 | 18 | 24.0 | opposite-strand | CBS domain |
| 11 | PF03061.24 | 1.0 | 18 | 24.0 | opposite-strand | Thioesterase superfamily |
| 12 | PF13483.8 | 0.78 | 14 | 1495.0 | opposite-strand | Beta-lactamase superfamily domain |
| 13 | PF12706.9 | 0.78 | 14 | 1495.0 | opposite-strand | Beta-lactamase superfamily domain |
| 14 | PF00753.29 | 0.78 | 14 | 1495.0 | opposite-strand | Metallo-beta-lactamase superfamily |
| 15 | PF13561.8 | 0.78 | 14 | 2259.5 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 16 | PF00106.27 | 0.78 | 14 | 2259.5 | opposite-strand | short chain dehydrogenase |
| 17 | PF13460.8 | 0.78 | 14 | 2259.5 | opposite-strand | NAD(P)H-binding |