Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YflI |
NCBI Accession ID | D86417.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 12602 |
Right | 12757 |
Strand | + |
Nucleotide Sequence | ATGTGGTTTATTATTTTCGGCATCATTTTTTTCATTGAAGGCATCATTATGACCGTTTACGGCGTTAAGAAAAAAAACGGGATGCTCACATATATCGGCATTGTTTTCGCCATTATGACATTTGGCGTTGTCATGATCAAACTAACCGGCCATTAA |
Sequence | MWFIIFGIIFFIEGIIMTVYGVKKKNGMLTYIGIVFAIMTFGVVMIKLTGH |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9272861 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O34905 |
ORF Length (Amino Acid) | 51 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 819705 | 819860 | - | NZ_CP013984.1 | Bacillus inaquosorum |
2 | 815776 | 815931 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 839077 | 839232 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
4 | 1163779 | 1163934 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 841059 | 841214 | - | NZ_CP051464.1 | Bacillus mojavensis |
6 | 1027366 | 1027521 | - | NZ_CP033052.1 | Bacillus vallismortis |
7 | 772998 | 773153 | - | NZ_CP048852.1 | Bacillus tequilensis |
8 | 3176389 | 3176544 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 776187 | 776342 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 847609 | 847764 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 801237 | 801392 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 882092 | 882247 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 745454 | 745615 | + | NZ_CP043404.1 | Bacillus safensis |
14 | 752285 | 752446 | - | NZ_CP011150.1 | Bacillus altitudinis |
15 | 865776 | 865937 | + | NZ_CP017786.1 | Bacillus xiamenensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00753.29 | 0.6 | 9 | 2559 | opposite-strand | Metallo-beta-lactamase superfamily |
2 | PF02898.17 | 0.73 | 11 | 1347 | opposite-strand | Nitric oxide synthase, oxygenase domain |
3 | PF00708.20 | 1.0 | 15 | 1081 | same-strand | Acylphosphatase |
4 | PF03473.19 | 1.0 | 15 | 335 | opposite-strand | MOSC domain |
5 | PF03475.16 | 1.0 | 15 | 335 | opposite-strand | 3-alpha domain |
6 | PF11121.10 | 1.0 | 15 | 157 | same-strand | Protein of unknown function (DUF2639) |
7 | PF11588.10 | 0.6 | 9 | 107 | same-strand | Protein of unknown function (DUF3243) |
8 | PF00557.26 | 1.0 | 15 | 452 | same-strand | Metallopeptidase family M24 |
9 | PF02378.20 | 1.0 | 15 | 1424 | opposite-strand | Phosphotransferase system, EIIC |
10 | PF00367.22 | 1.0 | 15 | 1424 | opposite-strand | phosphotransferase system, EIIB |
11 | PF00884.25 | 0.73 | 11 | 2817 | same-strand | Sulfatase |