Result : O34891
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjzB |
| NCBI Accession ID | D86376.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4114 |
| Right | 4353 |
| Strand | - |
| Nucleotide Sequence | ATGCAGTTGGATGTGTTTTCAAGAATGATGTTCGGCGATGCAGCAAAACCAACAGAAGAGAAGGAGGAGGAACAGCAAGAGGAAGTTTCTCAGGTTTCTCAGACAAACGACGAAGAGACGATTAATTACATGCATATTATGGACCAAATCGGTTCAATTATGAACTCTCTTGATCAAATCAAGCCCGCTTTAAAGGAGCTTGCGCCCATGCTCTCCGCTATTAAAAAGAAAATCATGTGA |
| Sequence | MQLDVFSRMMFGDAAKPTEEKEEEQQEEVSQVSQTNDEETINYMHIMDQIGSIMNSLDQIKPALKELAPMLSAIKKKIM |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9335269 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34891 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1207818 | 1208057 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1185970 | 1186197 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1134151 | 1134384 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1371324 | 1371524 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 781767 | 781997 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1211596 | 1211826 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1176959 | 1177159 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 8 | 2837270 | 2837488 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1107908 | 1108126 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11151.10 | 1.0 | 9 | 2906 | same-strand | Protein of unknown function (DUF2929) |
| 2 | PF02608.16 | 1.0 | 9 | 236 | opposite-strand | ABC transporter substrate-binding protein PnrA-like |
| 3 | PF10815.10 | 1.0 | 9 | 30 | opposite-strand | ComZ |
| 4 | PF08541.12 | 1.0 | 9 | 166 | opposite-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 5 | PF08545.12 | 1.0 | 9 | 166 | opposite-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 6 | PF02797.17 | 1.0 | 9 | 166 | opposite-strand | Chalcone and stilbene synthases, C-terminal domain |
| 7 | PF00109.28 | 1.0 | 9 | 1127 | opposite-strand | Beta-ketoacyl synthase, N-terminal domain |
| 8 | PF02801.24 | 1.0 | 9 | 1127 | opposite-strand | Beta-ketoacyl synthase, C-terminal domain |
| 9 | PF10026.11 | 1.0 | 9 | 2445 | opposite-strand | Predicted Zn-dependent protease (DUF2268) |
| 10 | PF00005.29 | 1.0 | 9 | 3920.5 | opposite-strand | ABC transporter |
| 11 | PF08352.14 | 1.0 | 9 | 3449 | opposite-strand | Oligopeptide/dipeptide transporter, C-terminal region |
| 12 | PF02463.21 | 1.0 | 9 | 3447.5 | opposite-strand | RecF/RecN/SMC N terminal domain |
++ More..