Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YjzB |
NCBI Accession ID | D86376.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 4114 |
Right | 4353 |
Strand | - |
Nucleotide Sequence | ATGCAGTTGGATGTGTTTTCAAGAATGATGTTCGGCGATGCAGCAAAACCAACAGAAGAGAAGGAGGAGGAACAGCAAGAGGAAGTTTCTCAGGTTTCTCAGACAAACGACGAAGAGACGATTAATTACATGCATATTATGGACCAAATCGGTTCAATTATGAACTCTCTTGATCAAATCAAGCCCGCTTTAAAGGAGCTTGCGCCCATGCTCTCCGCTATTAAAAAGAAAATCATGTGA |
Sequence | MQLDVFSRMMFGDAAKPTEEKEEEQQEEVSQVSQTNDEETINYMHIMDQIGSIMNSLDQIKPALKELAPMLSAIKKKIM |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9335269 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O34891 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1207818 | 1208057 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1185970 | 1186197 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1134151 | 1134384 | - | NZ_CP048852.1 | Bacillus tequilensis |
4 | 1371324 | 1371524 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 781767 | 781997 | + | NZ_CP029364.1 | Bacillus halotolerans |
6 | 1211596 | 1211826 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 1176959 | 1177159 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
8 | 2837270 | 2837488 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 1107908 | 1108126 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF11151.10 | 1.0 | 9 | 2906 | same-strand | Protein of unknown function (DUF2929) |
2 | PF02608.16 | 1.0 | 9 | 236 | opposite-strand | ABC transporter substrate-binding protein PnrA-like |
3 | PF10815.10 | 1.0 | 9 | 30 | opposite-strand | ComZ |
4 | PF08541.12 | 1.0 | 9 | 166 | opposite-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
5 | PF08545.12 | 1.0 | 9 | 166 | opposite-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
6 | PF02797.17 | 1.0 | 9 | 166 | opposite-strand | Chalcone and stilbene synthases, C-terminal domain |
7 | PF00109.28 | 1.0 | 9 | 1127 | opposite-strand | Beta-ketoacyl synthase, N-terminal domain |
8 | PF02801.24 | 1.0 | 9 | 1127 | opposite-strand | Beta-ketoacyl synthase, C-terminal domain |
9 | PF10026.11 | 1.0 | 9 | 2445 | opposite-strand | Predicted Zn-dependent protease (DUF2268) |
10 | PF00005.29 | 1.0 | 9 | 3920.5 | opposite-strand | ABC transporter |
11 | PF08352.14 | 1.0 | 9 | 3449 | opposite-strand | Oligopeptide/dipeptide transporter, C-terminal region |
12 | PF02463.21 | 1.0 | 9 | 3447.5 | opposite-strand | RecF/RecN/SMC N terminal domain |