Result : O34867
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YlqH |
| NCBI Accession ID | AJ000975.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 124 |
| Right | 405 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGAGCAGACACCGATCAGAAAAGCTGTTGCTCTCCATTATGACGAACAAAAAGACAAGGCGCCGAGAGTGATTGCCACAGGGAAGGGCCATGTAGCTGACAACATTATAAAAGAAGCGAAAAAAGCAGGGGTCCCGATTCAAGAAGATCGGACCCTTGTCGAATTAATGCGCCATTTGACGGTAGATGATCAAATTCCTGAAGCTCTTTATGAAACGGTAGCCGAGATTTTTTCATTCATTTACAAATTGGACGAAAGCGTAAAAAACAAAAAATAG |
| Sequence | MKEQTPIRKAVALHYDEQKDKAPRVIATGKGHVADNIIKEAKKAGVPIQEDRTLVELMRHLTVDDQIPEALYETVAEIFSFIYKLDESVKNKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl19167. Profile Description: FlhB HrpN YscU SpaS Family. type III secretion system protein HrcU; Validated |
| Pubmed ID | 9384377 |
| Domain | CDD:418535 |
| Functional Category | Others |
| Uniprot ID | O34867 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 103
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1679977 | 1680258 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1647776 | 1648057 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1652848 | 1653129 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1587660 | 1587941 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1858348 | 1858629 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 305881 | 306162 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1684097 | 1684378 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2325975 | 2326256 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1634890 | 1635171 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3737448 | 3737723 | - | NZ_CP043404.1 | Bacillus safensis |
| 11 | 1581462 | 1581737 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 117734 | 118009 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 1785287 | 1785568 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1807241 | 1807519 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 1807906 | 1808190 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 3390919 | 3391188 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 17 | 1556012 | 1556287 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 18 | 1699544 | 1699837 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 19 | 944024 | 944308 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 20 | 3408509 | 3408778 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 21 | 2592371 | 2592649 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 22 | 2715813 | 2716115 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 23 | 1561699 | 1562019 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 24 | 1255635 | 1255862 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 25 | 1844084 | 1844401 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 26 | 1085328 | 1085651 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 27 | 1205354 | 1205677 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 28 | 2559714 | 2559989 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 29 | 2782699 | 2782947 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 30 | 2179069 | 2179371 | + | NZ_CP053989.1 | Niallia circulans |
| 31 | 1685846 | 1686130 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 32 | 1110292 | 1110615 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 33 | 4958198 | 4958482 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 34 | 6369393 | 6369692 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 35 | 1809249 | 1809503 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 36 | 3465012 | 3465296 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 37 | 1271560 | 1271838 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 38 | 1804807 | 1805103 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 39 | 1437900 | 1438175 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 40 | 1191332 | 1191610 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 41 | 1935390 | 1935665 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 42 | 537020 | 537283 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 43 | 3034274 | 3034561 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 44 | 1108126 | 1108449 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 45 | 1802022 | 1802264 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 46 | 1324633 | 1324860 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 47 | 2834370 | 2834630 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 48 | 806076 | 806384 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 49 | 4590948 | 4591196 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 50 | 3592823 | 3593080 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 51 | 2019154 | 2019423 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 52 | 1318069 | 1318335 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 53 | 1771514 | 1771813 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 54 | 1753792 | 1754052 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 55 | 145999 | 146289 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 56 | 3978364 | 3978675 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 57 | 1662678 | 1662962 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 58 | 1282345 | 1282605 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 59 | 1475202 | 1475504 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 60 | 3512227 | 3512520 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 61 | 2334068 | 2334343 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 62 | 1670712 | 1670996 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 63 | 1774777 | 1775067 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 64 | 1749125 | 1749400 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 65 | 1310567 | 1310818 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 66 | 1172765 | 1173007 | + | NZ_CP059443.1 | Campylobacter fetus |
| 67 | 707522 | 707794 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 68 | 2663707 | 2663997 | - | NZ_LS483476.1 | Lederbergia lentus |
| 69 | 1151261 | 1151524 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 70 | 4167412 | 4167714 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 71 | 1642071 | 1642331 | - | NZ_CP012543.1 | Campylobacter rectus |
| 72 | 1360428 | 1360721 | + | NZ_CP012024.1 | Bacillus smithii |
| 73 | 1274746 | 1275009 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 74 | 1324884 | 1325156 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 75 | 1669805 | 1670077 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 76 | 2560737 | 2561021 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 77 | 795223 | 795504 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 78 | 703830 | 704069 | + | NZ_CP012544.1 | Campylobacter showae |
| 79 | 1225842 | 1226099 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 80 | 143741 | 143992 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 81 | 600192 | 600452 | + | NZ_CP012541.1 | Campylobacter concisus |
| 82 | 142306 | 142566 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 83 | 81555 | 81833 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 84 | 1427141 | 1427425 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 85 | 2612042 | 2612344 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 86 | 123722 | 124000 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 87 | 934572 | 934838 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 88 | 67913 | 68191 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 89 | 121224 | 121502 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 90 | 272142 | 272405 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 91 | 673686 | 673943 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 92 | 2661705 | 2661983 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 93 | 517823 | 518104 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 94 | 1654989 | 1655240 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 95 | 1118129 | 1118419 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 96 | 4057576 | 4057848 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 97 | 540832 | 541119 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 98 | 1603684 | 1603947 | - | NC_012438.1 | Sulfurihydrogenibium azorense Az-Fu1 |
| 99 | 952238 | 952516 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 100 | 311695 | 311952 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 101 | 1667733 | 1667978 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 102 | 1049681 | 1049908 | + | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 103 | 1988778 | 1989005 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
++ More..