Result : O34855
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YocN |
| NCBI Accession ID | AF027868.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 79122 |
| Right | 79355 |
| Strand | + |
| Nucleotide Sequence | ATGTTCTTTTCACCCTCCGTCGTAAATGTCGGCGGATTTAAAATCAATACGATGGATCGAGGTTCCTCTTTAACACTCGGTCCGTATCAGCAGGTCGATTACTTTTTATCAGCTAAAATAAATCAAGGGTTTGGAGAAGAAAATGGCGACTTTACTCCTCTTGTCGTGCCGATTTCAAATGTATTAGATGCAGATCTTGTTGATTCGAACTCAGCGAAAAACAGTGTGGTGTAA |
| Sequence | MFFSPSVVNVGGFKINTMDRGSSLTLGPYQQVDYFLSAKINQGFGEENGDFTPLVVPISNVLDADLVDSNSAKNSVV |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34855 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2099127 | 2099360 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2114187 | 2114420 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 784521 | 784754 | - | NZ_CP043404.1 | Bacillus safensis |
| 4 | 890110 | 890343 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 5 | 717773 | 718006 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 6 | 2406502 | 2406735 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 7 | 1895289 | 1895522 | - | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 2055163 | 2055396 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 4116076 | 4116309 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 10 | 2542011 | 2542244 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 11 | 2770512 | 2770745 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 12 | 347066 | 347284 | + | NZ_CP065425.1 | Heyndrickxia vini |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00011.23 | 0.83 | 10 | 335.0 | opposite-strand | Hsp20/alpha crystallin family |
| 2 | PF17886.3 | 0.75 | 9 | 335 | opposite-strand | HSP20-like domain found in ArsA |
++ More..