Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YocN |
NCBI Accession ID | AF027868.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 79122 |
Right | 79355 |
Strand | + |
Nucleotide Sequence | ATGTTCTTTTCACCCTCCGTCGTAAATGTCGGCGGATTTAAAATCAATACGATGGATCGAGGTTCCTCTTTAACACTCGGTCCGTATCAGCAGGTCGATTACTTTTTATCAGCTAAAATAAATCAAGGGTTTGGAGAAGAAAATGGCGACTTTACTCCTCTTGTCGTGCCGATTTCAAATGTATTAGATGCAGATCTTGTTGATTCGAACTCAGCGAAAAACAGTGTGGTGTAA |
Sequence | MFFSPSVVNVGGFKINTMDRGSSLTLGPYQQVDYFLSAKINQGFGEENGDFTPLVVPISNVLDADLVDSNSAKNSVV |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O34855 |
ORF Length (Amino Acid) | 77 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2099127 | 2099360 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2114187 | 2114420 | + | NZ_CP048852.1 | Bacillus tequilensis |
3 | 784521 | 784754 | - | NZ_CP043404.1 | Bacillus safensis |
4 | 890110 | 890343 | - | NZ_CP017786.1 | Bacillus xiamenensis |
5 | 717773 | 718006 | + | NZ_CP011150.1 | Bacillus altitudinis |
6 | 2406502 | 2406735 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
7 | 1895289 | 1895522 | - | NZ_CP011937.1 | Bacillus velezensis |
8 | 2055163 | 2055396 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 4116076 | 4116309 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
10 | 2542011 | 2542244 | + | NZ_CP024035.1 | Priestia aryabhattai |
11 | 2770512 | 2770745 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
12 | 347066 | 347284 | + | NZ_CP065425.1 | Heyndrickxia vini |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00011.23 | 0.83 | 10 | 335.0 | opposite-strand | Hsp20/alpha crystallin family |
2 | PF17886.3 | 0.75 | 9 | 335 | opposite-strand | HSP20-like domain found in ArsA |