Result : A3CKI0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 10 kDa chaperonin (GroES protein) (Protein Cpn10) |
| NCBI Accession ID | CP000387.1 |
| Organism | Streptococcus sanguinis (strain SK36) |
| Left | 218782 |
| Right | 219063 |
| Strand | + |
| Nucleotide Sequence | ATGTTAAAACCATTAGGAGACCGTGTGGTCTTAAAAGTAGAAGAAAAAGAGCAGAAAGTTGGCGGATTTGTCATTGCAGGCAATGGCCAAGCAGCGACTAAGACAGCTGAAGTTGTAGCAGTCGGACAAGGTATTCGTACTTTGAACGGTGAGCTGGTAGCCCTGAGCGTTAAGGAAGGGGACAAGGTTCTCGTAGAAAATCACGCAGGCGTGGAAGTCAAGGACGGAGAGGAAGCTTATCTCTTAGTCAGTGAAGCCAATATTCTAGCAGTTGTCGAGTAA |
| Sequence | MLKPLGDRVVLKVEEKEQKVGGFVIAGNGQAATKTAEVVAVGQGIRTLNGELVALSVKEGDKVLVENHAGVEVKDGEEAYLLVSEANILAVVE |
| Source of smORF | Swiss-Prot |
| Function | Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter. {ECO:0000255|HAMAP-Rule:MF_00580}. |
| Pubmed ID | 17277061 |
| Domain | CDD:415587 |
| Functional Category | Others |
| Uniprot ID | A3CKI0 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 74
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 277275 | 277556 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 2 | 235916 | 236197 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 3 | 1661099 | 1661380 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 4 | 1793970 | 1794251 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 5 | 1531898 | 1532182 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 6 | 360146 | 360430 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 7 | 1382701 | 1382985 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 8 | 1842401 | 1842685 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 9 | 1945898 | 1946179 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 10 | 771836 | 772120 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 11 | 669597 | 669881 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 12 | 123729 | 124013 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 13 | 133787 | 134068 | + | NC_012924.1 | Streptococcus suis SC84 |
| 14 | 1808274 | 1808561 | + | NZ_CP013237.1 | Streptococcus mutans |
| 15 | 868686 | 868973 | + | NZ_CP043405.1 | Streptococcus ratti |
| 16 | 136351 | 136632 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 17 | 2238964 | 2239248 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 18 | 156171 | 156455 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 19 | 231956 | 232243 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 20 | 1930753 | 1931037 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 21 | 143665 | 143949 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 22 | 936647 | 936931 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 23 | 545200 | 545484 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 24 | 1963663 | 1963947 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 25 | 212313 | 212585 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 26 | 237422 | 237709 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 27 | 320026 | 320310 | + | NZ_LS483343.1 | Streptococcus ferus |
| 28 | 1881084 | 1881371 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 29 | 172447 | 172731 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 30 | 1432243 | 1432527 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 31 | 1375931 | 1376218 | - | NZ_CP024610.1 | Lactobacillus terrae |
| 32 | 1245402 | 1245686 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 33 | 144386 | 144670 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 34 | 928256 | 928540 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 35 | 1541266 | 1541550 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 36 | 2072154 | 2072438 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 37 | 1888869 | 1889153 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 38 | 1358595 | 1358879 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 39 | 2198024 | 2198305 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 40 | 503773 | 504057 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 41 | 1586377 | 1586658 | - | NZ_LT906439.1 | Streptococcus merionis |
| 42 | 1855956 | 1856246 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 43 | 1690344 | 1690628 | - | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 44 | 2006730 | 2007014 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 45 | 412340 | 412624 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 46 | 390163 | 390447 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 47 | 352451 | 352735 | - | NZ_CP012033.1 | Levilactobacillus koreensis |
| 48 | 1440296 | 1440580 | - | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 49 | 574786 | 575070 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 50 | 420341 | 420625 | + | NZ_CP045530.1 | Limosilactobacillus pontis |
| 51 | 1198530 | 1198814 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 52 | 724750 | 725040 | + | NZ_LR134293.1 | Streptococcus canis |
| 53 | 400999 | 401283 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 54 | 816579 | 816863 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 55 | 2040504 | 2040794 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 56 | 1330358 | 1330648 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 57 | 2022075 | 2022359 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 58 | 409962 | 410252 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 59 | 743207 | 743491 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 60 | 665431 | 665715 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 61 | 1203409 | 1203651 | - | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 62 | 551042 | 551326 | + | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 63 | 2116046 | 2116330 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 64 | 651973 | 652257 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 65 | 1754787 | 1755041 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 66 | 608254 | 608538 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 67 | 1901385 | 1901669 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 68 | 684122 | 684376 | + | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 69 | 581962 | 582216 | + | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 70 | 573407 | 573682 | + | NZ_CP027563.1 | Weissella confusa |
| 71 | 121696 | 121980 | - | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 72 | 4738783 | 4739076 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 73 | 943442 | 943684 | - | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 74 | 388741 | 389025 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012805.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00118.26 | 1.0 | 74 | 45.0 | same-strand | TCP-1/cpn60 chaperonin family |
++ More..