Result : O34850
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YotN |
| NCBI Accession ID | AF006665.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3929 |
| Right | 4105 |
| Strand | + |
| Nucleotide Sequence | TTGGAACCTTACCAACGTTATGAGGAATTAAAGAAAAAAACAATAAAGGTAGTCCAGAAAGAAAATTACAGTATTCGATATATAACTCAGGATGAAGCAAGTAATGACTTAGATGAGTTTTATAAACAATTTGCTCAACATTTATTAGAAGCTGCTCTGGAAAGGAAGGCAGAGTAA |
| Sequence | MEPYQRYEELKKKTIKVVQKENYSIRYITQDEASNDLDEFYKQFAQHLLEAALERKAE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9734814 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34850 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2152086 | 2152262 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1838087 | 1838263 | + | NZ_CP011937.1 | Bacillus velezensis |
| 3 | 2112550 | 2112726 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011937.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12996.9 | 1.0 | 3 | 1976 | opposite-strand | DUF based on E. rectale Gene description (DUF3880) |
| 2 | PF13524.8 | 1.0 | 3 | 1976 | opposite-strand | Glycosyl transferases group 1 |
| 3 | PF02333.17 | 1.0 | 3 | 775 | same-strand | Phytase |
| 4 | PF11518.10 | 0.67 | 2 | 357.0 | same-strand | Protein of unknown function (DUF3221) |
++ More..