Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized protein YotN |
NCBI Accession ID | AF006665.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 3929 |
Right | 4105 |
Strand | + |
Nucleotide Sequence | TTGGAACCTTACCAACGTTATGAGGAATTAAAGAAAAAAACAATAAAGGTAGTCCAGAAAGAAAATTACAGTATTCGATATATAACTCAGGATGAAGCAAGTAATGACTTAGATGAGTTTTATAAACAATTTGCTCAACATTTATTAGAAGCTGCTCTGGAAAGGAAGGCAGAGTAA |
Sequence | MEPYQRYEELKKKTIKVVQKENYSIRYITQDEASNDLDEFYKQFAQHLLEAALERKAE |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9734814 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O34850 |
ORF Length (Amino Acid) | 58 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2152086 | 2152262 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1838087 | 1838263 | + | NZ_CP011937.1 | Bacillus velezensis |
3 | 2112550 | 2112726 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12996.9 | 1.0 | 3 | 1976 | opposite-strand | DUF based on E. rectale Gene description (DUF3880) |
2 | PF13524.8 | 1.0 | 3 | 1976 | opposite-strand | Glycosyl transferases group 1 |
3 | PF02333.17 | 1.0 | 3 | 775 | same-strand | Phytase |
4 | PF11518.10 | 0.67 | 2 | 357.0 | same-strand | Protein of unknown function (DUF3221) |