Result : O34800
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Stage II sporulation protein SB (Antidote protein SpoIISB) (Antitoxin SpoIISB) |
| NCBI Accession ID | AJ002571.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 574 |
| Right | 744 |
| Strand | - |
| Nucleotide Sequence | ATGGAACGTGCGTTTCAAAACAGATGCGAGCCCAGAGCGGCGAAGCCGTTTAAAATCCTGAAAAAACGTTCAACCACCAGTGTCGCAAGCTATCAAGTCAGTCCGCATACAGCAAGAATCTTCAAAGAAAACGAACGGCTGATTGACGAGTATAAACGAAAAAAAGCATGA |
| Sequence | MERAFQNRCEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEYKRKKA |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Antitoxin that binds cognate toxin SpoIISA and neutralizes its toxic activity; unlike most antitoxins it does not seem to be highly labile upon expression in E.coli. {ECO:0000269|Pubmed:11371520}. |
| Pubmed ID | 9384377 11371520 18096016 21147767 |
| Domain | CDD:290888 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | O34800 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1348442 | 1348612 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1321845 | 1322015 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1318292 | 1318462 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1517720 | 1517890 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1265655 | 1265825 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 637360 | 637530 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1357182 | 1357352 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2689759 | 2689929 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1271324 | 1271494 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1247207 | 1247377 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 448039 | 448209 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 296672 | 296842 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1453766 | 1453939 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 1351825 | 1351998 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 1383506 | 1383679 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10779.11 | 0.6 | 9 | 1441 | opposite-strand | Haemolysin XhlA |
| 2 | PF04688.15 | 0.6 | 9 | 1165 | opposite-strand | SPP1 phage holin |
| 3 | PF01510.27 | 0.8 | 12 | 258.5 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
| 4 | PF01476.22 | 0.8 | 12 | 258.5 | opposite-strand | LysM domain |
| 5 | PF01471.20 | 0.8 | 12 | 258.5 | opposite-strand | Putative peptidoglycan binding domain |
| 6 | PF14171.8 | 1.0 | 15 | 0 | same-strand | Toxin SpoIISA, type II toxin-antitoxin system |
| 7 | PF01865.18 | 1.0 | 15 | 1870 | same-strand | Protein of unknown function DUF47 |
| 8 | PF13520.8 | 0.6 | 9 | 2764 | same-strand | Amino acid permease |
| 9 | PF00324.23 | 0.6 | 9 | 2764 | same-strand | Amino acid permease |
| 10 | PF13906.8 | 0.6 | 9 | 2764 | same-strand | C-terminus of AA permease |
| 11 | PF00903.27 | 0.6 | 9 | 4465 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
++ More..