Result : O34795
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YbcH |
| NCBI Accession ID | AB006424.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13201 |
| Right | 13491 |
| Strand | + |
| Nucleotide Sequence | ATGAGCGCTAATTTAACTGATTTTGTCACGAAAACAATAGAGGAAATGAACTCGTTTGATCGTGAAAATATGGAATGTATAAAAAAACTAATTAGAAAAGCAATTGATTTTTATCATCTAAAGTCTTATGAAGAAGTTGAGGAAACCCATTCAGGAAATGTTCGATTTTTGCATGTCCACTCTATGATGGAAGAAAATATGTTATCCAAAATGATAGTGGTCACAAGAAACGGTAAAACTGATTTGGATATTGAAGGTGTATATGAAGGATATGTTGTAAGAGAATATTAA |
| Sequence | MSANLTDFVTKTIEEMNSFDRENMECIKKLIRKAIDFYHLKSYEEVEETHSGNVRFLHVHSMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34795 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 210224 | 210514 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 175772 | 176062 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 210058 | 210348 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 1800429 | 1800719 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 206340 | 206630 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 352620 | 352910 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 207704 | 207994 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00361.22 | 1.0 | 7 | 3297 | same-strand | Proton-conducting membrane transporter |
| 2 | PF10070.11 | 1.0 | 7 | 667 | same-strand | Na+-translocating membrane potential-generating system (MpsB) |
| 3 | PF10057.11 | 1.0 | 7 | 58 | same-strand | Na+-translocating membrane potential-generating system (MpsC) |
| 4 | PF12840.9 | 0.71 | 5 | 758 | same-strand | Helix-turn-helix domain |
| 5 | PF07690.18 | 0.71 | 5 | 1185 | same-strand | Major Facilitator Superfamily |
++ More..