Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized HTH-type transcriptional regulator YopO |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2207748 |
Right | 2207960 |
Strand | - |
Nucleotide Sequence | ATGTCAGAGCGAATAAAACAGCTAATGGTCAAACGTGGCATCACAATAGAGGAATTGTCGAGGGAGACAATGATTGATATGCAGACATTAAACAAAATCATTGAAATGCCAGATGAATCAGATGTTACAACCATAAAGCTTATCGCTCTGGTGTTGAATGTCTCTATTGATGAGTTATTAGATGAGAAAGGAGGAGAAGATAATGCAAAATAA |
Sequence | MSERIKQLMVKRGITIEELSRETMIDMQTLNKIIEMPDESDVTTIKLIALVLNVSIDELLDEKGGEDNAK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
Pubmed ID | 9384377 |
Domain | CDD:419869 |
Functional Category | DNA-binding |
Uniprot ID | O34791 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2207748 | 2207960 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1791297 | 1791509 | + | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF09467.12 | 1.0 | 2 | 4151.5 | same-strand | Hypothetical protein Yopt |
2 | PF13443.8 | 1.0 | 2 | 3745.0 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
3 | PF01381.24 | 1.0 | 2 | 3745.0 | opposite-strand | Helix-turn-helix |
4 | PF14072.8 | 1.0 | 2 | 1173.0 | same-strand | DNA-sulfur modification-associated |
5 | PF00589.24 | 1.0 | 2 | -10.0 | same-strand | Phage integrase family |