Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized HTH-type transcriptional regulator YopS |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2203779 |
Right | 2204003 |
Strand | + |
Nucleotide Sequence | ATGATTAAAGTTGAGATCGGGCAATGCTTGATACCTGAATTATGTAGAAAGAAAGACATTACAATCAATGAACTTTCAGAGATAACTGGGATTAAGAAACAGCAGCTGAGCGACTATAATCGATTAGTTAAAGTAGATATGTCTATTCGAACTGCAAAAAGAATTGCTGCTGCTTTAGATTGTAATGTCGAAGACCTCTATGAATTCAAGGTTGAAAGGCATTGA |
Sequence | MIKVEIGQCLIPELCRKKDITINELSEITGIKKQQLSDYNRLVKVDMSIRTAKRIAAALDCNVEDLYEFKVERH |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
Pubmed ID | 9384377 |
Domain | CDD:419869 |
Functional Category | DNA-binding |
Uniprot ID | O34766 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1795254 | 1795478 | - | NZ_CP048852.1 | Bacillus tequilensis |
2 | 2203779 | 2204003 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01381.24 | 1.0 | 2 | 3745.0 | opposite-strand | Helix-turn-helix |
2 | PF13443.8 | 1.0 | 2 | 3745.0 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
3 | PF12844.9 | 1.0 | 2 | 3745.0 | opposite-strand | Helix-turn-helix domain |
4 | PF00589.24 | 1.0 | 2 | 2679.0 | opposite-strand | Phage integrase family |
5 | PF14072.8 | 1.0 | 2 | 1190.0 | opposite-strand | DNA-sulfur modification-associated |
6 | PF09467.12 | 1.0 | 2 | 182.5 | opposite-strand | Hypothetical protein Yopt |
7 | PF09643.12 | 1.0 | 2 | 1368.5 | opposite-strand | YopX protein |