Protein Information |
Information Type | Description |
---|---|
Protein name | Stress response protein YkoL |
NCBI Accession ID | AJ002571.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 50308 |
Right | 50490 |
Strand | + |
Nucleotide Sequence | ATGAGTAATTTATTGAAATCCGCTTTAGAAAAAGAACGACGCCATTATTCTGAAAAACTCTATCAGATAGGGGTTTATAATAAAGAGGTCATGAACAAAATGACGATTTCTGAGCTTCGGAAAGAATACGCTTATTTCTTTCGAAGCATTACAAATCATAAAAATTATCCTTATACAAGATAA |
Sequence | MSNLLKSALEKERRHYSEKLYQIGVYNKEVMNKMTISELRKEYAYFFRSITNHKNYPYTR |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 11988534 |
Domain | |
Functional Category | Others |
Uniprot ID | O34763 |
ORF Length (Amino Acid) | 60 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1398181 | 1398363 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1369679 | 1369861 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 1580498 | 1580680 | + | NZ_CP033052.1 | Bacillus vallismortis |
4 | 1373309 | 1373491 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 1310171 | 1310353 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 1408603 | 1408785 | + | NZ_CP051464.1 | Bacillus mojavensis |
7 | 585883 | 586065 | - | NZ_CP029364.1 | Bacillus halotolerans |
8 | 2639856 | 2640038 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 1320664 | 1320846 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 1526297 | 1526476 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
11 | 1443421 | 1443591 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
12 | 2746656 | 2746841 | - | NZ_CP016020.1 | Bacillus weihaiensis |
13 | 1465240 | 1465419 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01769.18 | 0.85 | 11 | 812 | same-strand | Divalent cation transporter |
2 | PF03448.19 | 0.85 | 11 | 812 | same-strand | MgtE intracellular N domain |
3 | PF00571.30 | 0.85 | 11 | 812 | same-strand | CBS domain |
4 | PF13411.8 | 1.0 | 13 | 438 | opposite-strand | MerR HTH family regulatory protein |
5 | PF00376.25 | 1.0 | 13 | 438 | opposite-strand | MerR family regulatory protein |
6 | PF01047.24 | 1.0 | 13 | 138 | same-strand | MarR family |
7 | PF13463.8 | 1.0 | 13 | 138 | same-strand | Winged helix DNA-binding domain |
8 | PF12802.9 | 1.0 | 13 | 138 | same-strand | MarR family |
9 | PF13601.8 | 1.0 | 13 | 138 | same-strand | Winged helix DNA-binding domain |