Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YdjO |
NCBI Accession ID | AB007638.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 12747 |
Right | 12956 |
Strand | - |
Nucleotide Sequence | ATGTCTTACTATAACAAACGAAATCAAGAACCGCTGCCAAAGGAAGATGTGAGTACTTGGGAATGCACAAAAGAAGACTGTAATGGCTGGACCCGAAAAAACTTCGCCAGCAGTGATACGCCATTGTGCCCTTTGTGCGGAAGTAAAATGGTCGACGGCATCCGTTCATTAGTGAATCTCCAAAACAACAGCCAAACGAAAACAAGCTAG |
Sequence | MSYYNKRNQEPLPKEDVSTWECTKEDCNGWTRKNFASSDTPLCPLCGSKMVDGIRSLVNLQNNSQTKTS |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14169. Profile Description: Cold-inducible protein YdjO. This family includes the B. subtilis YdjO protein, which is functionally uncharacterized. This is not a homolog of E. coli YdjO. B. subtilis YdjO is cold-inducible. Its expression is induced by the extracytoplasmic function sigma factor sigma-W. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. |
Pubmed ID | 9455482 9384377 21710567 |
Domain | CDD:372943 |
Functional Category | Others |
Uniprot ID | O34759 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 643672 | 643881 | - | NZ_CP048852.1 | Bacillus tequilensis |
2 | 620125 | 620334 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1331763 | 1331972 | + | NZ_CP029364.1 | Bacillus halotolerans |
4 | 681255 | 681464 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
5 | 818204 | 818413 | - | NZ_CP033052.1 | Bacillus vallismortis |
6 | 666534 | 666743 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 660793 | 661002 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
8 | 3303560 | 3303769 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 645160 | 645369 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 3471883 | 3472107 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
11 | 3246772 | 3246996 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 3650067 | 3650291 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08240.14 | 0.75 | 9 | 2299 | same-strand | Alcohol dehydrogenase GroES-like domain |
2 | PF00107.28 | 0.75 | 9 | 2299 | same-strand | Zinc-binding dehydrogenase |
3 | PF16912.7 | 0.75 | 9 | 2299 | same-strand | Glucose dehydrogenase C-terminus |
4 | PF03330.20 | 0.75 | 9 | 1489 | opposite-strand | Lytic transglycolase |
5 | PF07731.16 | 0.75 | 9 | 2000 | same-strand | Multicopper oxidase |
6 | PF00324.23 | 0.75 | 9 | 3690 | same-strand | Amino acid permease |
7 | PF13520.8 | 0.75 | 9 | 3690 | same-strand | Amino acid permease |