Result : O34719
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YvlC |
| NCBI Accession ID | AF017113.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 21003 |
| Right | 21200 |
| Strand | + |
| Nucleotide Sequence | ATGAATAAGCTTTATCGCTCAGAAAAAAATAAGAAAATCGCCGGTGTTATCGGAGGTCTCGCGGAATATTTCAATTGGGACGCATCACTCCTCAGAGTCATAACTGTCATCTTAGCCATTATGACAAGTGTCTTGCCGGTTTTGCTCATTTATATCATTTGGATTTTTATCGTCCCGTCAGAAAGGGATATGAAATGA |
| Sequence | MNKLYRSEKNKKIAGVIGGLAEYFNWDASLLRVITVILAIMTSVLPVLLIYIIWIFIVPSERDMK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00864. Profile Description: PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length. |
| Pubmed ID | 9384377 |
| Domain | CDD:412614 |
| Functional Category | Others |
| Uniprot ID | O34719 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3607123 | 3607320 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3426095 | 3426292 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3468610 | 3468807 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3463227 | 3463424 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 3409577 | 3409774 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 2648444 | 2648641 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 3389977 | 3390174 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3999125 | 3999322 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 3575228 | 3575428 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 3769201 | 3769401 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 3468554 | 3468748 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 12 | 576881 | 577075 | + | NZ_CP011937.1 | Bacillus velezensis |
| 13 | 2209154 | 2209348 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 3151616 | 3151810 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 2146755 | 2146949 | + | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3860167 | 3860367 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 17 | 1966451 | 1966636 | - | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 18 | 2794520 | 2794678 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 19 | 1246386 | 1246571 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 20 | 1434877 | 1435065 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 21 | 1064087 | 1064245 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 22 | 520475 | 520693 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 23 | 1609766 | 1609987 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 24 | 4813878 | 4814063 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 25 | 3303068 | 3303232 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 26 | 2559122 | 2559310 | + | NZ_CP048222.1 | Rhodocytophaga rosea |
| 27 | 1690414 | 1690632 | - | NZ_CP009288.1 | Paenibacillus durus |
| 28 | 1833671 | 1833856 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 29 | 942276 | 942470 | + | NZ_CP068168.1 | Corynebacterium amycolatum |
| 30 | 2513426 | 2513599 | + | NZ_CP013195.1 | Prevotella enoeca |
| 31 | 102273 | 102482 | - | NC_011295.1 | Coprothermobacter proteolyticus DSM 5265 |
| 32 | 1933177 | 1933365 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
++ More..