Result : O34713
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YjzD |
| NCBI Accession ID | D86376.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1027 |
| Right | 1212 |
| Strand | - |
| Nucleotide Sequence | GTGCGATATATTATTGCCTTTATTTGGACGTTCCTTTTATCACATATGGCATGCTACTTGGTTGCAAGCATGAACAGCGTTACGTATAATTTCAAAACATCATCTGTCATTGCTGTTGTACTGTATGTCTTAATCATGGTTTTAGCAGAAATCATGCCTATGAACAAAAATGCAAGCCAGCATTAA |
| Sequence | MRYIIAFIWTFLLSHMACYLVASMNSVTYNFKTSSVIAVVLYVLIMVLAEIMPMNKNASQH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam11151. Profile Description: Protein of unknown function (DUF2929). This family of proteins with unknown function appears to be restricted to Firmicutes. |
| Pubmed ID | 9335269 9384377 |
| Domain | CDD:402631 |
| Functional Category | Others |
| Uniprot ID | O34713 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1204731 | 1204916 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1173868 | 1174053 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1182880 | 1183065 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1131066 | 1131251 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1368236 | 1368430 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 784919 | 785104 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1208487 | 1208672 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1104802 | 1104987 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2840406 | 2840591 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 394000 | 394194 | + | NZ_CP043404.1 | Bacillus safensis |
| 11 | 523484 | 523678 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 1283776 | 1283961 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00202.23 | 0.83 | 10 | 5475.0 | opposite-strand | Aminotransferase class-III |
| 2 | PF00988.24 | 1.0 | 12 | 4343.5 | opposite-strand | Carbamoyl-phosphate synthase small chain, CPSase domain |
| 3 | PF00117.30 | 1.0 | 12 | 4343.5 | opposite-strand | Glutamine amidotransferase class-I |
| 4 | PF02786.19 | 1.0 | 12 | 1258.5 | opposite-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 5 | PF02787.21 | 1.0 | 12 | 1258.5 | opposite-strand | Carbamoyl-phosphate synthetase large chain, oligomerisation domain |
| 6 | PF02222.24 | 1.0 | 12 | 1258.5 | opposite-strand | ATP-grasp domain |
| 7 | PF02655.16 | 1.0 | 12 | 1258.5 | opposite-strand | ATP-grasp domain |
| 8 | PF15632.8 | 1.0 | 12 | 1258.5 | opposite-strand | ATP-grasp in the biosynthetic pathway with Ter operon |
| 9 | PF01071.21 | 0.92 | 11 | 1259 | opposite-strand | Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain |
| 10 | PF13535.8 | 0.92 | 11 | 1259 | opposite-strand | ATP-grasp domain |
| 11 | PF00185.26 | 1.0 | 12 | 326.0 | opposite-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| 12 | PF02729.23 | 1.0 | 12 | 326.0 | opposite-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| 13 | PF14168.8 | 1.0 | 12 | 46.0 | opposite-strand | YjzC-like protein |
| 14 | PF02608.16 | 1.0 | 12 | 1722.5 | opposite-strand | ABC transporter substrate-binding protein PnrA-like |
| 15 | PF10815.10 | 1.0 | 12 | 2689.0 | opposite-strand | ComZ |
++ More..