Result : O34700
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YebG |
| NCBI Accession ID | U51115.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 15312 |
| Right | 15509 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAAGCCGAAGAAGAAAAAGTTTGAAGTGACAGAGCAGCAAACGATTGATGCGGTGCTTCAGCAAATGAAAGAAGAAGGATATCTGCCTGTAAGGCGAATGGAAGAGCCTATTTTTATGGAAAAAAAGGAAAATGGGTCAATTCAGATCGTTCCGTGCGGGAAAAAAATCGTATTTGAAGGGAAATTGATCTAA |
| Sequence | MAKPKKKKFEVTEQQTIDAVLQQMKEEGYLPVRRMEEPIFMEKKENGSIQIVPCGKKIVFEGKLI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14044. Profile Description: NETI protein. This family includes the B. subtilis YebG protein, which is functionally uncharacterized. This is not a homolog of E. coli YebG, which belongs to pfam07130. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 66 amino acids in length and contain a conserved NETI motif. |
| Pubmed ID | 8969499 9384377 |
| Domain | CDD:404854 |
| Functional Category | Others |
| Uniprot ID | O34700 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 677452 | 677649 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 638875 | 639072 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 698092 | 698289 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 662361 | 662558 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 851820 | 852017 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1311833 | 1312030 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 683095 | 683292 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 660710 | 660907 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3285642 | 3285839 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 765116 | 765313 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 749161 | 749358 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 696756 | 696953 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 963206 | 963373 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 644925 | 645092 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 908514 | 908681 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 3231310 | 3231510 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 17 | 2193033 | 2193233 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 18 | 2065657 | 2065857 | + | NZ_CP040336.1 | Bacillus luti |
| 19 | 2175677 | 2175877 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 20 | 3183579 | 3183779 | - | NC_011725.1 | Bacillus cereus B4264 |
| 21 | 3083307 | 3083507 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 22 | 3075954 | 3076154 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 23 | 24140 | 24355 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 24 | 546030 | 546248 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 25 | 2875348 | 2875548 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 26 | 348072 | 348281 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 27 | 3006866 | 3007036 | - | NZ_CP012024.1 | Bacillus smithii |
| 28 | 3842039 | 3842239 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 29 | 541679 | 541888 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 30 | 1740013 | 1740207 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 31 | 1640627 | 1640821 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 32 | 1120265 | 1120459 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 33 | 817516 | 817710 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 34 | 2417778 | 2417948 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 35 | 2012013 | 2012201 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 36 | 235125 | 235328 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 37 | 2803799 | 2803996 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 38 | 734352 | 734555 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 39 | 273887 | 274090 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 40 | 1449210 | 1449389 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 41 | 601358 | 601525 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 42 | 676175 | 676372 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 43 | 249511 | 249711 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 44 | 1952737 | 1952940 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 45 | 3576476 | 3576685 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 46 | 1824952 | 1825146 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 47 | 443278 | 443478 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 48 | 1459065 | 1459241 | - | NZ_CP068061.1 | Mammaliicoccus vitulinus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18955.2 | 0.6 | 29 | 0 | same-strand | Domain of unknown function (DUF5698) |
| 2 | PF10035.11 | 0.6 | 29 | 0 | same-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 3 | PF00731.22 | 0.75 | 36 | 322.0 | same-strand | AIR carboxylase |
| 4 | PF02222.24 | 0.73 | 35 | 803 | same-strand | ATP-grasp domain |
| 5 | PF17769.3 | 0.73 | 35 | 803 | same-strand | Phosphoribosylaminoimidazole carboxylase C-terminal domain |
| 6 | PF00206.22 | 0.75 | 36 | 1942.0 | same-strand | Lyase |
| 7 | PF10397.11 | 0.75 | 36 | 1942.0 | same-strand | Adenylosuccinate lyase C-terminus |
| 8 | PF01259.20 | 0.73 | 35 | 3312 | same-strand | SAICAR synthetase |
| 9 | PF02700.16 | 0.73 | 35 | 4030 | same-strand | Phosphoribosylformylglycinamidine (FGAM) synthase |
++ More..