Result : O34679
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjiA |
| NCBI Accession ID | AF015825.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 9914 |
| Right | 10192 |
| Strand | - |
| Nucleotide Sequence | GTGGCAGCACAGACTGATTACAAAAAACAAGTTGTCGGAATCCTACTTTCACTTGCATTCGTACTCTTTGTGTTCTCTTTTTCTGAGAGACATGAAAAACCGCTTGTTGAGGGAAAAAAACAGGAAAACTGGCATACTGTCGTCGACAAAGCCTCCGTCAAAATTTATGGCAGCCGATTAGTTGAAGAAAACAAATTAAAGCAAAAACTCGGCCATAAACAAGCCGATTCTATTTTGACCCTTCTGAAACTCGCCAACGAAAAACACATTACATTATAA |
| Sequence | MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRLVEENKLKQKLGHKQADSILTLLKLANEKHITL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34679 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1290675 | 1290953 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1265344 | 1265622 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1259108 | 1259386 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 694837 | 695115 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1220319 | 1220597 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1299069 | 1299347 | - | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14172.8 | 1.0 | 6 | 5233.0 | same-strand | Domain of unknown function (DUF4309) |
| 2 | PF00384.24 | 1.0 | 6 | 2127.0 | opposite-strand | Molybdopterin oxidoreductase |
| 3 | PF01568.23 | 1.0 | 6 | 2127.0 | opposite-strand | Molydopterin dinucleotide binding domain |
| 4 | PF04879.18 | 1.0 | 6 | 2127.0 | opposite-strand | Molybdopterin oxidoreductase Fe4S4 domain |
| 5 | PF13510.8 | 1.0 | 6 | 2127.0 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 6 | PF00037.29 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S binding domain |
| 7 | PF10588.11 | 1.0 | 6 | 2127.0 | opposite-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 8 | PF14697.8 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
| 9 | PF12838.9 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
| 10 | PF13183.8 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
| 11 | PF13187.8 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
| 12 | PF07849.13 | 1.0 | 6 | 1574.0 | opposite-strand | Protein of unknown function (DUF1641) |
| 13 | PF11611.10 | 1.0 | 6 | 736.5 | opposite-strand | Domain of unknown function (DUF4352) |
| 14 | PF12535.10 | 1.0 | 6 | 32.0 | opposite-strand | Hydrolase of X-linked nucleoside diphosphate N terminal |
| 15 | PF00293.30 | 0.83 | 5 | 32 | opposite-strand | NUDIX domain |
| 16 | PF00067.24 | 0.83 | 5 | 391 | opposite-strand | Cytochrome P450 |
| 17 | PF02602.17 | 1.0 | 6 | 3187.0 | opposite-strand | Uroporphyrinogen-III synthase HemD |
| 18 | PF03649.15 | 0.83 | 5 | 4043 | same-strand | Uncharacterised protein family (UPF0014) |
++ More..