Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YjiA |
NCBI Accession ID | AF015825.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 9914 |
Right | 10192 |
Strand | - |
Nucleotide Sequence | GTGGCAGCACAGACTGATTACAAAAAACAAGTTGTCGGAATCCTACTTTCACTTGCATTCGTACTCTTTGTGTTCTCTTTTTCTGAGAGACATGAAAAACCGCTTGTTGAGGGAAAAAAACAGGAAAACTGGCATACTGTCGTCGACAAAGCCTCCGTCAAAATTTATGGCAGCCGATTAGTTGAAGAAAACAAATTAAAGCAAAAACTCGGCCATAAACAAGCCGATTCTATTTTGACCCTTCTGAAACTCGCCAACGAAAAACACATTACATTATAA |
Sequence | MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRLVEENKLKQKLGHKQADSILTLLKLANEKHITL |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O34679 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1290675 | 1290953 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1265344 | 1265622 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1259108 | 1259386 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 694837 | 695115 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 1220319 | 1220597 | - | NZ_CP048852.1 | Bacillus tequilensis |
6 | 1299069 | 1299347 | - | NZ_CP051464.1 | Bacillus mojavensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14172.8 | 1.0 | 6 | 5233.0 | same-strand | Domain of unknown function (DUF4309) |
2 | PF00384.24 | 1.0 | 6 | 2127.0 | opposite-strand | Molybdopterin oxidoreductase |
3 | PF01568.23 | 1.0 | 6 | 2127.0 | opposite-strand | Molydopterin dinucleotide binding domain |
4 | PF04879.18 | 1.0 | 6 | 2127.0 | opposite-strand | Molybdopterin oxidoreductase Fe4S4 domain |
5 | PF13510.8 | 1.0 | 6 | 2127.0 | opposite-strand | 2Fe-2S iron-sulfur cluster binding domain |
6 | PF00037.29 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S binding domain |
7 | PF10588.11 | 1.0 | 6 | 2127.0 | opposite-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
8 | PF14697.8 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
9 | PF12838.9 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
10 | PF13183.8 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
11 | PF13187.8 | 1.0 | 6 | 2127.0 | opposite-strand | 4Fe-4S dicluster domain |
12 | PF07849.13 | 1.0 | 6 | 1574.0 | opposite-strand | Protein of unknown function (DUF1641) |
13 | PF11611.10 | 1.0 | 6 | 736.5 | opposite-strand | Domain of unknown function (DUF4352) |
14 | PF12535.10 | 1.0 | 6 | 32.0 | opposite-strand | Hydrolase of X-linked nucleoside diphosphate N terminal |
15 | PF00293.30 | 0.83 | 5 | 32 | opposite-strand | NUDIX domain |
16 | PF00067.24 | 0.83 | 5 | 391 | opposite-strand | Cytochrome P450 |
17 | PF02602.17 | 1.0 | 6 | 3187.0 | opposite-strand | Uroporphyrinogen-III synthase HemD |
18 | PF03649.15 | 0.83 | 5 | 4043 | same-strand | Uncharacterised protein family (UPF0014) |