Result : O34654
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YodI |
| NCBI Accession ID | AF015775.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8188 |
| Right | 8439 |
| Strand | + |
| Nucleotide Sequence | TTGGAGAGATATTATCATCTTTGCAAAAACCATCAAGGTAAAGTCGTCAGAATTACAGAGAGAGGCGGGAGAGTTCACGTCGGCAGAATTACCCGTGTAACAAGAGACAGAGTTTTTATAGCTCCGGTCGGCGGAGGGCCAAGAGGTTTCGGTTACGGATATTGGGGCGGTTATTGGGGATATGGAGCGGCTTACGGGATTTCCCTCGGTTTAATTGCAGGAGTGGCTCTGGCTGGTTTATTCTTCTGGTAA |
| Sequence | MERYYHLCKNHQGKVVRITERGGRVHVGRITRVTRDRVFIAPVGGGPRGFGYGYWGGYWGYGAAYGISLGLIAGVALAGLFFW |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9734814 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34654 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2134244 | 2134495 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2224231 | 2224482 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 2147051 | 2147302 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2077146 | 2077397 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 2137897 | 2138148 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1856973 | 1857224 | - | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 2067380 | 2067640 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3989064 | 3989324 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 9 | 2093495 | 2093749 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2240621 | 2240875 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 3315140 | 3315391 | - | NZ_CP043404.1 | Bacillus safensis |
| 12 | 1973162 | 1973413 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 2448203 | 2448460 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 3406128 | 3406385 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 2341804 | 2342058 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 1728765 | 1729019 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 489500 | 489745 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11755.10 | 0.71 | 12 | 3867.5 | same-strand | Protein of unknown function (DUF3311) |
| 2 | PF00474.19 | 0.76 | 13 | 2378 | same-strand | Sodium:solute symporter family |
| 3 | PF03572.20 | 0.94 | 16 | 942.5 | opposite-strand | Peptidase family S41 |
| 4 | PF17820.3 | 0.94 | 16 | 942.5 | opposite-strand | PDZ domain |
| 5 | PF00595.26 | 0.94 | 16 | 942.5 | opposite-strand | PDZ domain |
| 6 | PF13180.8 | 0.94 | 16 | 942.5 | opposite-strand | PDZ domain |
| 7 | PF01471.20 | 0.94 | 16 | 942.5 | opposite-strand | Putative peptidoglycan binding domain |
| 8 | PF08241.14 | 1.0 | 17 | 93 | same-strand | Methyltransferase domain |
| 9 | PF13649.8 | 1.0 | 17 | 93 | same-strand | Methyltransferase domain |
| 10 | PF13847.8 | 0.82 | 14 | 89.0 | same-strand | Methyltransferase domain |
| 11 | PF13489.8 | 0.88 | 15 | 93 | same-strand | Methyltransferase domain |
| 12 | PF08242.14 | 1.0 | 17 | 93 | same-strand | Methyltransferase domain |
| 13 | PF02557.19 | 0.94 | 16 | 58.5 | opposite-strand | D-alanyl-D-alanine carboxypeptidase |
| 14 | PF01048.22 | 0.94 | 16 | 949.5 | opposite-strand | Phosphorylase superfamily |
| 15 | PF01569.23 | 0.71 | 12 | 2387.0 | opposite-strand | PAP2 superfamily |
++ More..