| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative glutaredoxin YtnI |
| NCBI Accession ID | AF008220.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 175794 |
| Right | 176075 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGATGTTGTGAACATTGTGGTTTGGAGTAAAAAAGGCTGTTCGTATTGTGAGGAAGTCAAGAATTATTTGAATGAAAAAGGGTTCCCGTTCCAAAATATCGATGTTTCAGAGAAAGAAAAGCTTCGGGATATTTTACAGGTGAAATATGGGGTGCGCCATGTGCCTGTGGTCGAAATCGGGCGCGGCAATCAGTATCAAGGGATAACTGAAATCGGCATTGAACACCTTGATCTTGCACTTGCTAATCATGCACAGATAAAGGAGGCAAAAAGATGA |
| Sequence | MSDVVNIVVWSKKGCSYCEEVKNYLNEKGFPFQNIDVSEKEKLRDILQVKYGVRHVPVVEIGRGNQYQGITEIGIEHLDLALANHAQIKEAKR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
| Pubmed ID | 9387221 9384377 |
| Domain | CDD:412351 |
| Functional Category | Others |
| Uniprot ID | O34639 |
| ORF Length (Amino Acid) | 93 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3003049 | 3003330 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2882026 | 2882307 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2820160 | 2820441 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 3291028 | 3291309 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 734520 | 734807 | + | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 3286621 | 3286908 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 749324 | 749560 | + | NZ_CP012024.1 | Bacillus smithii |
| 8 | 1017919 | 1018185 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 9 | 1727203 | 1727463 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 10 | 1928602 | 1928862 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 11 | 960524 | 960796 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 12 | 1359330 | 1359596 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 13 | 1320016 | 1320294 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 14 | 2983706 | 2983990 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 15 | 3421230 | 3421508 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 16 | 1329508 | 1329786 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 17 | 2413219 | 2413485 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 18 | 538486 | 538773 | + | NZ_CP014164.1 | Aerococcus viridans |
| 19 | 1671762 | 1672049 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00296.22 | 0.95 | 18 | 13 | same-strand | Luciferase-like monooxygenase |
| 2 | PF00005.29 | 0.74 | 14 | 1016 | same-strand | ABC transporter |
| 3 | PF02463.21 | 0.68 | 13 | 1027.5 | same-strand | RecF/RecN/SMC N terminal domain |
| 4 | PF00528.24 | 0.95 | 18 | 1939 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 5 | PF00497.22 | 0.89 | 17 | 3220 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |