Result : O34604
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YvkN |
| NCBI Accession ID | AF017113.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 19102 |
| Right | 19332 |
| Strand | - |
| Nucleotide Sequence | ATGGAGAAAGATCCCAGTGACTATACAGTAACACAAGAATCAGTGTTAAAGCTGATTCAGGAACAAAAAAGAATGAATCGTGAAATGATCACCGAGCTTGAGCAGATTCACGGACCCTTCCCGATCTCTCACGATATCCAATATATAAAAGTGCTGCTCGACAGCAGCAACACACATATTGTTCAAGATTTAATGAGTGTAAGTAAGCAGCTGTATAAGAAGACTTTGTAA |
| Sequence | MEKDPSDYTVTQESVLKLIQEQKRMNREMITELEQIHGPFPISHDIQYIKVLLDSSNTHIVQDLMSVSKQLYKKTL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34604 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3608991 | 3609221 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3411446 | 3411676 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3470478 | 3470708 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2646543 | 2646773 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3391843 | 3392073 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3465098 | 3465334 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 3427963 | 3428193 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3470400 | 3470639 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 574991 | 575230 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3153453 | 3153683 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 2207283 | 2207513 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 2144882 | 2145112 | - | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04020.15 | 1.0 | 12 | 1869.0 | opposite-strand | Mycobacterial 4 TMS phage holin, superfamily IV |
| 2 | PF04024.14 | 1.0 | 12 | 1670.0 | opposite-strand | PspC domain |
| 3 | PF13349.8 | 1.0 | 12 | 568.0 | opposite-strand | Putative adhesin |
| 4 | PF09922.11 | 0.75 | 9 | 569 | opposite-strand | Cell wall-active antibiotics response 4TMS YvqF |
| 5 | PF17760.3 | 1.0 | 12 | 46.5 | opposite-strand | UvrA interaction domain |
| 6 | PF17755.3 | 1.0 | 12 | 46.5 | opposite-strand | UvrA DNA-binding domain |
| 7 | PF00005.29 | 1.0 | 12 | 46.5 | opposite-strand | ABC transporter |
| 8 | PF17757.3 | 1.0 | 12 | 2927.5 | opposite-strand | UvrB interaction domain |
| 9 | PF12344.10 | 1.0 | 12 | 2927.5 | opposite-strand | Ultra-violet resistance protein B |
| 10 | PF00271.33 | 1.0 | 12 | 2927.5 | opposite-strand | Helicase conserved C-terminal domain |
| 11 | PF02151.21 | 1.0 | 12 | 2927.5 | opposite-strand | UvrB/uvrC motif |
| 12 | PF09964.11 | 1.0 | 12 | 5193.5 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2198) |
| 13 | PF01326.21 | 0.83 | 10 | 5814.0 | same-strand | Pyruvate phosphate dikinase, AMP/ATP-binding domain |
| 14 | PF00391.25 | 0.83 | 10 | 5814.0 | same-strand | PEP-utilising enzyme, mobile domain |
| 15 | PF00440.25 | 0.67 | 8 | 8342.5 | same-strand | Bacterial regulatory proteins, tetR family |
++ More..