Result : O34588
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkuJ |
| NCBI Accession ID | AJ222587.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 18475 |
| Right | 18714 |
| Strand | + |
| Nucleotide Sequence | ATGTCACAATTAATGGGTATCATCACACGGCTGCAAAGTCTGCAAGAAACAGCGGAAGCGGCTAACGAGCCAATGCAGCGTTATTTCGAAGTGAATGGTGAGAAAATATGCAGTGTTAAATATTTCGAAAAAAATCAAACGTTTGAACTGACGGTTTTCCAAAAGGGTGAAAAACCTAACACATATCCGTTTGATAATATCGACATGGTTTCCATCGAAATCTTTGAACTTCTTCAGTAA |
| Sequence | MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELLQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11550. Profile Description: Protein of unknown function (DUF1797). This is a domain of unknown function. It forms a central anti-parallel beta sheet with flanking alpha helical regions. |
| Pubmed ID | 9384377 |
| Domain | CDD:416315 |
| Functional Category | Others |
| Uniprot ID | O34588 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1661012 | 1661251 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 1389433 | 1389672 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1447914 | 1448153 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1455618 | 1455857 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 501261 | 501500 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1484117 | 1484356 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 7 | 2566915 | 2567154 | - | NZ_CP011937.1 | Bacillus velezensis |
| 8 | 1391462 | 1391701 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1487620 | 1487859 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 310180 | 310422 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 1386764 | 1387006 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 145971 | 146213 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1603083 | 1603325 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 1589158 | 1589400 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 1612557 | 1612799 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 2610471 | 2610707 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 897762 | 898001 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 18 | 2017272 | 2017508 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 19 | 1394779 | 1395036 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 20 | 1309439 | 1309675 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 21 | 5120645 | 5120881 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 22 | 304577 | 304813 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 23 | 2016340 | 2016576 | + | NZ_CP053989.1 | Niallia circulans |
| 24 | 1289483 | 1289731 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 25 | 1584490 | 1584726 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 26 | 2765881 | 2766117 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 27 | 1204340 | 1204591 | + | NZ_CP012024.1 | Bacillus smithii |
| 28 | 1888981 | 1889217 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 29 | 4010546 | 4010782 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 30 | 1360410 | 1360646 | + | NZ_CP040336.1 | Bacillus luti |
| 31 | 4003737 | 4003973 | - | NC_011725.1 | Bacillus cereus B4264 |
| 32 | 3843807 | 3844043 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 33 | 3872086 | 3872322 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 34 | 4066680 | 4066919 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 35 | 1112165 | 1112404 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 36 | 1415617 | 1415853 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 37 | 1538828 | 1539067 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 38 | 3365215 | 3365466 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 39 | 2723395 | 2723649 | - | NZ_CP065425.1 | Heyndrickxia vini |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13561.8 | 0.77 | 30 | 2565.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 2 | PF00106.27 | 0.77 | 30 | 2565.0 | same-strand | short chain dehydrogenase |
| 3 | PF10388.11 | 0.9 | 35 | 1195 | same-strand | EAL-domain associated signalling protein domain |
| 4 | PF00563.22 | 0.92 | 36 | 1223 | same-strand | EAL domain |
| 5 | PF03466.22 | 0.85 | 33 | 1689 | same-strand | LysR substrate binding domain |
| 6 | PF00126.29 | 0.79 | 31 | 1689 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..