Result : O34555
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YoeD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2004262 |
| Right | 2004492 |
| Strand | - |
| Nucleotide Sequence | ATGTATTTAACGATTGAAGAAACAGCAGAATATACAAATCTTTCAGAGGATTATATTAAAAGCTTGGTGCTCGAAGGGAAAATCAGAGCCGTTCATGACGGGGAGCAATTTTTGATTTATAAGGAACAGTTCAAAACGCATCTCGAACAGCTGGAGAATTACAAAGCACTTGTGCAGGAAATATTAAATGAACCGATCCCGGAAGATATTGATGTAAAGGATGAGGATTAG |
| Sequence | MYLTIEETAEYTNLSEDYIKSLVLEGKIRAVHDGEQFLIYKEQFKTHLEQLENYKALVQEILNEPIPEDIDVKDED |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02600. Profile Description: Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. This domain is a DNA-binding helix-turn-helix domain. |
| Pubmed ID | 9384377 |
| Domain | CDD:413393 |
| Functional Category | Others |
| Uniprot ID | O34555 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 66
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2004262 | 2004492 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2017886 | 2018116 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 4116566 | 4116796 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 2006574 | 2006804 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 2118659 | 2118889 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1923729 | 1923959 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 1933918 | 1934148 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1941109 | 1941339 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2012034 | 2012264 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2224525 | 2224755 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2121513 | 2121743 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 12 | 983990 | 984220 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 13 | 2467803 | 2468033 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 14 | 372358 | 372588 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 15 | 341486 | 341716 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 16 | 3431283 | 3431513 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 17 | 378459 | 378689 | + | NC_011725.1 | Bacillus cereus B4264 |
| 18 | 1023313 | 1023543 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 19 | 3597638 | 3597871 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 20 | 4741647 | 4741877 | - | NZ_CP040336.1 | Bacillus luti |
| 21 | 365221 | 365451 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 22 | 381658 | 381888 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 23 | 1979548 | 1979778 | - | NZ_CP012024.1 | Bacillus smithii |
| 24 | 1193548 | 1193778 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 25 | 380189 | 380419 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 26 | 3416881 | 3417111 | + | NZ_CP043404.1 | Bacillus safensis |
| 27 | 3162415 | 3162645 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 28 | 285287 | 285517 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 29 | 900566 | 900796 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 30 | 2085104 | 2085334 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 31 | 3492506 | 3492736 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 32 | 574032 | 574262 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 33 | 1875934 | 1876164 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 34 | 207396 | 207626 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 35 | 1567084 | 1567314 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 36 | 493562 | 493792 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 37 | 1871508 | 1871738 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 38 | 1029134 | 1029367 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 39 | 2138784 | 2139014 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 40 | 640400 | 640630 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 41 | 1753677 | 1753907 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 42 | 852221 | 852454 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 43 | 3996045 | 3996275 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 44 | 3731608 | 3731838 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 45 | 354348 | 354578 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 46 | 1008450 | 1008680 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 47 | 772069 | 772299 | + | NZ_CP053989.1 | Niallia circulans |
| 48 | 755313 | 755543 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 49 | 1218502 | 1218732 | + | NZ_LS483476.1 | Lederbergia lentus |
| 50 | 3167953 | 3168183 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 51 | 2969694 | 2969924 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 52 | 2772264 | 2772494 | + | NZ_CP016540.2 | Planococcus versutus |
| 53 | 2769313 | 2769543 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 54 | 2869803 | 2870033 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 55 | 3098595 | 3098825 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 56 | 2336749 | 2336979 | - | NZ_CP013661.2 | Planococcus kocurii |
| 57 | 2924091 | 2924321 | + | NZ_CP019401.1 | Planococcus faecalis |
| 58 | 1327532 | 1327762 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 59 | 4424476 | 4424706 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 60 | 2084848 | 2085078 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 61 | 388769 | 388999 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 62 | 4282318 | 4282548 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 63 | 2647234 | 2647464 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 64 | 4445250 | 4445480 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 65 | 80757 | 80987 | + | NZ_CP019728.1 | Jeotgalibaca dankookensis |
| 66 | 887002 | 887232 | - | NZ_CP049889.1 | Jeotgalibaca porci |
++ More..