Result : O34503
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YtzD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3011555 |
| Right | 3011689 |
| Strand | - |
| Nucleotide Sequence | ATGATGAAAAAAGAACCGGAACGCTATATTTATGATGAACAAGAAAGCCAGGAGACAACAAGGCTCATTTCAGAAGCATATCAAAGCGGTTATGTCGATATGCCTGATCAGGAGTCTTCATCTCCTGCAGAATAA |
| Sequence | MMKKEPERYIYDEQESQETTRLISEAYQSGYVDMPDQESSSPAE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34503 |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3011555 | 3011689 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2890546 | 2890677 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 3282638 | 3282769 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 2805767 | 2805898 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 2883530 | 2883661 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 2813512 | 2813643 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 7 | 2828704 | 2828838 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2839670 | 2839798 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1146938 | 1147066 | + | NZ_CP011937.1 | Bacillus velezensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13483.8 | 1.0 | 9 | 957 | same-strand | Beta-lactamase superfamily domain |
| 2 | PF12706.9 | 1.0 | 9 | 957 | same-strand | Beta-lactamase superfamily domain |
| 3 | PF00753.29 | 1.0 | 9 | 957 | same-strand | Metallo-beta-lactamase superfamily |
| 4 | PF13561.8 | 1.0 | 9 | 127 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 5 | PF00106.27 | 1.0 | 9 | 127 | same-strand | short chain dehydrogenase |
| 6 | PF00206.22 | 1.0 | 9 | 65 | same-strand | Lyase |
| 7 | PF14698.8 | 1.0 | 9 | 65 | same-strand | Argininosuccinate lyase C-terminal |
| 8 | PF00764.21 | 1.0 | 9 | 1447 | same-strand | Arginosuccinate synthase |
| 9 | PF00994.26 | 1.0 | 9 | 2826 | same-strand | Probable molybdopterin binding domain |
| 10 | PF00871.19 | 1.0 | 9 | 3422 | same-strand | Acetokinase family |
| 11 | PF13649.8 | 0.67 | 6 | 4954.5 | same-strand | Methyltransferase domain |
| 12 | PF13460.8 | 0.67 | 6 | 129.0 | same-strand | NAD(P)H-binding |
++ More..