Result : O34498
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YopT |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2203378 |
| Right | 2203596 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGGTTATTTAAACAATATTGCACTGAATCTGGAGATTGTACTCAAAAACAAAGCAGATAGTCCAGAAGTCTCTGAAACATTAGTAACCAGGATTTGTGAAAATTTACTTTTATCTAAAGAAGTCTCGTTTTTAAAAGCTGACGGATCAGTTGAAAATTTTAAATTAAGTGATATGGAATATGAAATAACAAATACAGAAGAATTGCCTGAGTAA |
| Sequence | MAGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam09467. Profile Description: Hypothetical protein Yopt. This hypothetical protein is expressed in bacteria, particularly Bacillus subtilis. It forms homo-dimers, with each monomer consisting of one alpha helix and three beta strands. |
| Pubmed ID | 9384377 |
| Domain | CDD:401426 |
| Functional Category | Others |
| Uniprot ID | O34498 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1795660 | 1795878 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 2 | 2203378 | 2203596 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 1.0 | 2 | 2167.0 | both-strands | Helix-turn-helix |
| 2 | PF13443.8 | 1.0 | 2 | 2167.0 | both-strands | Cro/C1-type HTH DNA-binding domain |
| 3 | PF12844.9 | 1.0 | 2 | 4151.5 | same-strand | Helix-turn-helix domain |
| 4 | PF00589.24 | 1.0 | 2 | 3085.5 | same-strand | Phage integrase family |
| 5 | PF14072.8 | 1.0 | 2 | 1596.5 | same-strand | DNA-sulfur modification-associated |
| 6 | PF09643.12 | 1.0 | 2 | 968.0 | same-strand | YopX protein |
++ More..