Result : O34489
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YflD |
| NCBI Accession ID | D86417.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 7600 |
| Right | 7737 |
| Strand | - |
| Nucleotide Sequence | ATGAGGGAGAAAGTGGCGAAAAACGCCGTCGAATCAACGTTTCGCTTTGATATTACCAAATGTAAAACAAGGTATCTTTCTAGAAATAAAGGAATAAAATGGTACATTGAGAATTGTATGATAAAATATAAGGTATAG |
| Sequence | MREKVAKNAVESTFRFDITKCKTRYLSRNKGIKWYIENCMIKYKV |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9272861 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34489 |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 844097 | 844234 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 778034 | 778159 | + | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11588.10 | 1.0 | 2 | 4450.5 | opposite-strand | Protein of unknown function (DUF3243) |
| 2 | PF00557.26 | 1.0 | 2 | 3619.5 | opposite-strand | Metallopeptidase family M24 |
| 3 | PF02378.20 | 1.0 | 2 | 2089.5 | same-strand | Phosphotransferase system, EIIC |
| 4 | PF00367.22 | 1.0 | 2 | 2089.5 | same-strand | phosphotransferase system, EIIB |
| 5 | PF00884.25 | 1.0 | 2 | 107.5 | opposite-strand | Sulfatase |
| 6 | PF09350.12 | 1.0 | 2 | 19.0 | same-strand | Domain of unknown function (DUF1992) |
| 7 | PF01235.19 | 1.0 | 2 | 536.0 | same-strand | Sodium:alanine symporter family |
| 8 | PF03845.15 | 1.0 | 2 | 1948.0 | opposite-strand | Spore germination protein |
| 9 | PF05504.13 | 1.0 | 2 | 3265.0 | opposite-strand | Spore germination B3/ GerAC like, C-terminal |
++ More..