Result : O34464
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized HTH-type transcriptional regulator YceK |
| NCBI Accession ID | AB000617.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 33510 |
| Right | 33812 |
| Strand | - |
| Nucleotide Sequence | ATGTATTATAGTTTCATGACTATGAAACAATCAGATGATCAAATCAGAGCGCAAATTTTTAAAGCACTGTCTGATGAATCAAGGCTTGCCATTATTCGTACGCTTTATGTCAGCGGAAAAGAACTCAGCTGCGGTGAAGTAGGTGAAAAGTGCAATATTGTCAAAACCACGGCATCTTATCATTTTAAAACGCTGCGTGAAGCGGGATTGACGGCAACCCGGAAAGATTCGCGGACAAAATACGTCAGTCTGCGTGAAGACACATTTCAAACATACCTGCCTGGCTTTTTGGAAACCCTCTAA |
| Sequence | MYYSFMTMKQSDDQIRAQIFKALSDESRLAIIRTLYVSGKELSCGEVGEKCNIVKTTASYHFKTLREAGLTATRKDSRTKYVSLREDTFQTYLPGFLETL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl21459. Profile Description: Helix-turn-helix domains. This winged helix-turn-helix domain contains an extended C-terminal alpha helix which is responsible for dimerization of this domain. |
| Pubmed ID | 9274031 9384377 |
| Domain | CDD:419669 |
| Functional Category | DNA-binding |
| Uniprot ID | O34464 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 320421 | 320723 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 281569 | 281871 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 304215 | 304517 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1693578 | 1693880 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3135015 | 3135269 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 6 | 1163585 | 1163869 | + | NC_014136.1 | Leuconostoc kimchii IMSNU 11154 |
| 7 | 2943146 | 2943400 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 8 | 3457585 | 3457839 | + | NZ_CP009288.1 | Paenibacillus durus |
| 9 | 2802944 | 2803189 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 10 | 5360940 | 5361230 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 11 | 1035122 | 1035406 | - | NC_018631.1 | Leuconostoc gelidum JB7 |
| 12 | 716424 | 716687 | - | NZ_CP043405.1 | Streptococcus ratti |
| 13 | 5257474 | 5257764 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 14 | 159649 | 159930 | + | NZ_CP042374.1 | Leuconostoc carnosum |
| 15 | 5756242 | 5756517 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 16 | 5523867 | 5524142 | - | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 17 | 1633183 | 1633473 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 18 | 3928766 | 3929056 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 19 | 4393922 | 4394194 | - | NZ_CP034437.1 | Paenibacillus albus |
| 20 | 1972216 | 1972470 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 21 | 2998965 | 2999219 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 22 | 2835671 | 2835961 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 23 | 167673 | 167972 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 24 | 705890 | 706165 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 25 | 3207694 | 3207984 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 26 | 2277170 | 2277460 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 27 | 1456920 | 1457219 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 28 | 2410849 | 2411127 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 29 | 1115794 | 1116051 | + | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 30 | 2033441 | 2033737 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 31 | 2058549 | 2058845 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 32 | 613861 | 614109 | + | NZ_LT593929.1 | Propionibacterium freudenreichii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 0.83 | 25 | 75.0 | same-strand | Major Facilitator Superfamily |
++ More..