Result : O34446
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjpA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1317157 |
| Right | 1317414 |
| Strand | - |
| Nucleotide Sequence | ATGTATACATATTTAATGCTGACAATGAGAACGGAGAAATTTAATCAGGAGCATGTGGCTGGGCACTATGAATTTCTGGATCGTTTACAGGCAGAAAAACGTTTAAAAATGTTTGGGCCATTCAGCGACGCCACAGGCGGAGCGTATGTCATCGAAGCAGATTCACTGGAAGAGGCAGCGGAAATCGGCCATGCGGATCCGCTGGTGGCAAGTGGATCTTCTGAGCTGACGATAAAAGAATGGAAGCTGAAGAAATAA |
| Sequence | MYTYLMLTMRTEKFNQEHVAGHYEFLDRLQAEKRLKMFGPFSDATGGAYVIEADSLEEAAEIGHADPLVASGSSELTIKEWKLKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00999. Profile Description: YCII-related domain. YciI-like protein; Reviewed |
| Pubmed ID | 9384377 19383706 |
| Domain | CDD:412694 |
| Functional Category | Others |
| Uniprot ID | O34446 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1317157 | 1317414 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1290506 | 1290760 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1484864 | 1485118 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 1285618 | 1285872 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 668947 | 669201 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2286231 | 2286485 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 7 | 3056559 | 3056816 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 8 | 5788178 | 5788420 | - | NZ_CP009288.1 | Paenibacillus durus |
| 9 | 4139917 | 4140171 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 10 | 5274186 | 5274395 | - | NZ_LR134352.1 | Nocardia asteroides |
++ More..