Result : O34438
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjfB |
| NCBI Accession ID | AF015825.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2409 |
| Right | 2576 |
| Strand | - |
| Nucleotide Sequence | ATGGATATTCCTGCTTTATCGGTTGCGATGCATCAAGCATCCCTTGCCCAGAATGTAAATATTGCTTTAACGAAAAAAAGGCTGGACACCGCCCAGCAAAATGCCGATCAAACCTTAAAGATGATTCAACATCCAACTCTCGGACAAACCATTGATGTAAAAGCATAA |
| Sequence | MDIPALSVAMHQASLAQNVNIALTKKRLDTAQQNADQTLKMIQHPTLGQTIDVKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14070. Profile Description: Putative motility protein. This family of proteins is regulated in B. subtilis by SigD, and is likely to be involved in motility or flagellin production, Proteins in this family are approximately 60 amino acids in length, and contain two highly conserved asparagine residues. |
| Pubmed ID | 9579062 9384377 15033535 |
| Domain | CDD:404880 |
| Functional Category | Others |
| Uniprot ID | O34438 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1283169 | 1283336 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1251600 | 1251767 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1212813 | 1212980 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1444254 | 1444421 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1291576 | 1291743 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 702490 | 702657 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1201024 | 1201197 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 2760023 | 2760196 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 4696886 | 4697059 | - | NZ_CP053989.1 | Niallia circulans |
| 10 | 4702355 | 4702501 | - | NZ_CP053989.1 | Niallia circulans |
| 11 | 2818404 | 2818577 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 12 | 690286 | 690459 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 13 | 2372852 | 2373025 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 1434910 | 1435083 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 15 | 1308544 | 1308726 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 16 | 3268139 | 3268312 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 17 | 1430984 | 1431157 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 18 | 2176629 | 2176802 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 19 | 2269834 | 2270007 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 20 | 2881895 | 2882083 | + | NZ_CP012024.1 | Bacillus smithii |
++ More..