Result : O34405
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1395371 |
| Right | 1395508 |
| Strand | + |
| Nucleotide Sequence | ATGGAAAAGAAAGAGGAGCAATACATCAATCAGGCTGAATATGTCCCTCATCCGACGAAGGAAGGAGAGTATGCCTTATTTCTTCATGAAACGTATCATTTGCTTTCTGAAGATGACGAGACACAAACAACAGAATAA |
| Sequence | MEKKEEQYINQAEYVPHPTKEGEYALFLHETYHLLSEDDETQTTE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34405 |
| ORF Length (Amino Acid) | 45 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1366868 | 1367005 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 1370500 | 1370637 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1405787 | 1405924 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 1395371 | 1395508 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 5 | 1577688 | 1577825 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 588744 | 588881 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1307363 | 1307500 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 1317858 | 1317995 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2642706 | 2642843 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1522953 | 1523075 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 1420017 | 1420172 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 390690 | 390803 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 1305228 | 1305341 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 238910 | 239023 | - | NZ_CP043404.1 | Bacillus safensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00072.26 | 0.64 | 9 | 2733 | same-strand | Response regulator receiver domain |
| 2 | PF00486.30 | 0.64 | 9 | 2733 | same-strand | Transcriptional regulatory protein, C terminal |
| 3 | PF02518.28 | 0.64 | 9 | 1365 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 4 | PF00512.27 | 0.64 | 9 | 1365 | same-strand | His Kinase A (phospho-acceptor) domain |
| 5 | PF00672.27 | 0.64 | 9 | 1365 | same-strand | HAMP domain |
| 6 | PF03413.21 | 0.64 | 9 | 486.5 | same-strand | Peptidase propeptide and YPEB domain |
| 7 | PF01769.18 | 1.0 | 14 | 507.0 | same-strand | Divalent cation transporter |
| 8 | PF03448.19 | 1.0 | 14 | 507.0 | same-strand | MgtE intracellular N domain |
| 9 | PF00571.30 | 1.0 | 14 | 507.0 | same-strand | CBS domain |
| 10 | PF13411.8 | 0.93 | 13 | 1905 | opposite-strand | MerR HTH family regulatory protein |
| 11 | PF00376.25 | 0.93 | 13 | 1905 | opposite-strand | MerR family regulatory protein |
++ More..