Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YkzD |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1395371 |
Right | 1395508 |
Strand | + |
Nucleotide Sequence | ATGGAAAAGAAAGAGGAGCAATACATCAATCAGGCTGAATATGTCCCTCATCCGACGAAGGAAGGAGAGTATGCCTTATTTCTTCATGAAACGTATCATTTGCTTTCTGAAGATGACGAGACACAAACAACAGAATAA |
Sequence | MEKKEEQYINQAEYVPHPTKEGEYALFLHETYHLLSEDDETQTTE |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O34405 |
ORF Length (Amino Acid) | 45 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1366868 | 1367005 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
2 | 1370500 | 1370637 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1405787 | 1405924 | + | NZ_CP051464.1 | Bacillus mojavensis |
4 | 1395371 | 1395508 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
5 | 1577688 | 1577825 | + | NZ_CP033052.1 | Bacillus vallismortis |
6 | 588744 | 588881 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 1307363 | 1307500 | + | NZ_CP048852.1 | Bacillus tequilensis |
8 | 1317858 | 1317995 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 2642706 | 2642843 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 1522953 | 1523075 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
11 | 1420017 | 1420172 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 390690 | 390803 | - | NZ_CP017786.1 | Bacillus xiamenensis |
13 | 1305228 | 1305341 | + | NZ_CP011150.1 | Bacillus altitudinis |
14 | 238910 | 239023 | - | NZ_CP043404.1 | Bacillus safensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 0.64 | 9 | 2733 | same-strand | Response regulator receiver domain |
2 | PF00486.30 | 0.64 | 9 | 2733 | same-strand | Transcriptional regulatory protein, C terminal |
3 | PF02518.28 | 0.64 | 9 | 1365 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
4 | PF00512.27 | 0.64 | 9 | 1365 | same-strand | His Kinase A (phospho-acceptor) domain |
5 | PF00672.27 | 0.64 | 9 | 1365 | same-strand | HAMP domain |
6 | PF03413.21 | 0.64 | 9 | 486.5 | same-strand | Peptidase propeptide and YPEB domain |
7 | PF01769.18 | 1.0 | 14 | 507.0 | same-strand | Divalent cation transporter |
8 | PF03448.19 | 1.0 | 14 | 507.0 | same-strand | MgtE intracellular N domain |
9 | PF00571.30 | 1.0 | 14 | 507.0 | same-strand | CBS domain |
10 | PF13411.8 | 0.93 | 13 | 1905 | opposite-strand | MerR HTH family regulatory protein |
11 | PF00376.25 | 0.93 | 13 | 1905 | opposite-strand | MerR family regulatory protein |