Result : O34365
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YtmB |
| NCBI Accession ID | AF008220.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 47722 |
| Right | 47964 |
| Strand | + |
| Nucleotide Sequence | TTGGGAATGCCTGTTGAATTTAATACACTGATTGTGACAAAAGGAAAAGAAGTTCGCATAGATGAAAATATATTCACGTTAGAGAAGGACGGATACCGAGTATATCCGATGGAGATTCCAATGGATGTACGCAAAACAAAGTTTGGCGAAAAGTCAGGCACAGCTGAAGTGCAGAAGCTTCAATGGGAAGAAGGCCGGACCATCATTACATACAAGCTGACTTCTTTGCATTCCGTCAATTAA |
| Sequence | MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10763. Profile Description: Protein of unknown function (DUF2584). This bacterial family of proteins have no known function. |
| Pubmed ID | 9387221 9384377 |
| Domain | CDD:402408 |
| Functional Category | Others |
| Uniprot ID | O34365 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3131152 | 3131394 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2933556 | 2933798 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3010481 | 3010723 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3004152 | 3004394 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2936450 | 2936692 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 3162903 | 3163145 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 2925332 | 2925574 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1030805 | 1031047 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2954898 | 2955140 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3482000 | 3482242 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3269241 | 3269483 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 3084153 | 3084395 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2568316 | 2568558 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 2662734 | 2662976 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 2741990 | 2742232 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 3906783 | 3907025 | - | NZ_CP053989.1 | Niallia circulans |
| 17 | 1953785 | 1954027 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 18 | 3183897 | 3184139 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 19 | 1301194 | 1301436 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 20 | 887372 | 887614 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 3772888 | 3773130 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 22 | 1096740 | 1096982 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 23 | 3744120 | 3744362 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 24 | 2332517 | 2332759 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 25 | 2500348 | 2500590 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 26 | 410051 | 410293 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 27 | 177395 | 177637 | - | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 28 | 3526799 | 3527041 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 29 | 1797599 | 1797841 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 30 | 4626958 | 4627200 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 31 | 2881726 | 2881968 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 32 | 2092183 | 2092425 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 33 | 3039663 | 3039905 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 34 | 1025369 | 1025611 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 35 | 1212475 | 1212717 | + | NZ_LR134483.1 | Listeria grayi |
| 36 | 2128535 | 2128777 | - | NZ_CP011102.1 | Listeria weihenstephanensis |
| 37 | 3048116 | 3048358 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 38 | 1723356 | 1723598 | - | NC_003210.1 | Listeria monocytogenes EGD-e |
| 39 | 1669785 | 1670027 | - | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 40 | 1699682 | 1699924 | - | NZ_LT906444.1 | Listeria welshimeri |
| 41 | 2357980 | 2358222 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 42 | 2607403 | 2607645 | - | NZ_CP012024.1 | Bacillus smithii |
| 43 | 1775020 | 1775262 | - | NZ_CP009577.1 | Listeria ivanovii subsp. ivanovii |
| 44 | 3159570 | 3159812 | - | NZ_LS483476.1 | Lederbergia lentus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00733.23 | 0.61 | 27 | 3481 | same-strand | Asparagine synthase |
| 2 | PF13537.8 | 0.61 | 27 | 3481 | same-strand | Glutamine amidotransferase domain |
| 3 | PF13522.8 | 0.61 | 27 | 3481 | same-strand | Glutamine amidotransferase domain |
| 4 | PF02773.18 | 0.82 | 36 | 2143.0 | same-strand | S-adenosylmethionine synthetase, C-terminal domain |
| 5 | PF02772.18 | 0.82 | 36 | 2143.0 | same-strand | S-adenosylmethionine synthetase, central domain |
| 6 | PF00438.22 | 0.82 | 36 | 2143.0 | same-strand | S-adenosylmethionine synthetase, N-terminal domain |
| 7 | PF01293.22 | 0.73 | 32 | 42.5 | opposite-strand | Phosphoenolpyruvate carboxykinase |
| 8 | PF00326.23 | 0.82 | 36 | 52.0 | same-strand | Prolyl oligopeptidase family |
| 9 | PF13379.8 | 0.73 | 32 | 966.5 | opposite-strand | NMT1-like family |
| 10 | PF09084.13 | 0.73 | 32 | 966.5 | opposite-strand | NMT1/THI5 like |
| 11 | PF00005.29 | 0.73 | 32 | 1992.5 | opposite-strand | ABC transporter |
| 12 | PF00528.24 | 0.73 | 32 | 2750 | opposite-strand | Binding-protein-dependent transport system inner membrane component |
++ More..