Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived thioredoxin-like protein YosR |
NCBI Accession ID | AF012906.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 4110 |
Right | 4352 |
Strand | + |
Nucleotide Sequence | ATGAGATTAATTAAATTAGAGCAGCCTAATTGCAATCCATGTAAAATGGTGTCCAATTACTTAGAACAAGTAAATATTCAATTTGAGACTGTTGACGTTACACAGGAACCAGAAGTAGCAGCAAGATTTGGTGTCATGGGAGTACCGGTAACCATTCTGCTGAGTGATCAGGGAGAAGAAGTAAACCGAAGTGTTGGTTTTAAGCCTAATGAACTTGATGAGTTACTAAAGGAATTACGATAA |
Sequence | MRLIKLEQPNCNPCKMVSNYLEQVNIQFETVDVTQEPEVAARFGVMGVPVTILLSDQGEEVNRSVGFKPNELDELLKELR |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
Pubmed ID | 9679200 9384377 |
Domain | CDD:412351 |
Functional Category | Others |
Uniprot ID | O34342 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2159742 | 2159984 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1832347 | 1832589 | + | NZ_CP048852.1 | Bacillus tequilensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00692.21 | 1.0 | 2 | 261.5 | same-strand | dUTPase |
2 | PF02867.17 | 1.0 | 2 | 1703.0 | same-strand | Ribonucleotide reductase, barrel domain |
3 | PF08343.12 | 1.0 | 2 | 3095.0 | same-strand | Ribonucleotide reductase N-terminal |
4 | PF00317.23 | 1.0 | 2 | 3095.0 | same-strand | Ribonucleotide reductase, all-alpha domain |