Result : O34342
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived thioredoxin-like protein YosR |
| NCBI Accession ID | AF012906.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4110 |
| Right | 4352 |
| Strand | + |
| Nucleotide Sequence | ATGAGATTAATTAAATTAGAGCAGCCTAATTGCAATCCATGTAAAATGGTGTCCAATTACTTAGAACAAGTAAATATTCAATTTGAGACTGTTGACGTTACACAGGAACCAGAAGTAGCAGCAAGATTTGGTGTCATGGGAGTACCGGTAACCATTCTGCTGAGTGATCAGGGAGAAGAAGTAAACCGAAGTGTTGGTTTTAAGCCTAATGAACTTGATGAGTTACTAAAGGAATTACGATAA |
| Sequence | MRLIKLEQPNCNPCKMVSNYLEQVNIQFETVDVTQEPEVAARFGVMGVPVTILLSDQGEEVNRSVGFKPNELDELLKELR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
| Pubmed ID | 9679200 9384377 |
| Domain | CDD:412351 |
| Functional Category | Others |
| Uniprot ID | O34342 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2159742 | 2159984 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1832347 | 1832589 | + | NZ_CP048852.1 | Bacillus tequilensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00692.21 | 1.0 | 2 | 261.5 | same-strand | dUTPase |
| 2 | PF02867.17 | 1.0 | 2 | 1703.0 | same-strand | Ribonucleotide reductase, barrel domain |
| 3 | PF08343.12 | 1.0 | 2 | 3095.0 | same-strand | Ribonucleotide reductase N-terminal |
| 4 | PF00317.23 | 1.0 | 2 | 3095.0 | same-strand | Ribonucleotide reductase, all-alpha domain |
++ More..