Protein Information |
Information Type | Description |
---|---|
Protein name | SPbeta prophage-derived uncharacterized protein YoqI |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 2198070 |
Right | 2198264 |
Strand | - |
Nucleotide Sequence | ATGATTAAATCGATTATTTTACCTGAAGAAAACACAAAAATAACTGTAGGTAAACCGATAAATGATGAATCAAATACAAAGGTAATTGCTATTTATGACTATAGAGAAGAACCAGAAGAAGCTTTCTGGGTACACTTATCAAATGGGAATGATCTATTTGTAGATAACCATGAAGTCATTGTTGAGTATGAATAG |
Sequence | MIKSIILPEENTKITVGKPINDESNTKVIAIYDYREEPEEAFWVHLSNGNDLFVDNHEVIVEYE |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O34339 |
ORF Length (Amino Acid) | 64 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2198070 | 2198264 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2057004 | 2057198 | - | NZ_CP048852.1 | Bacillus tequilensis |
3 | 1964362 | 1964556 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 2156162 | 2156356 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 2047493 | 2047687 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF16302.7 | 0.8 | 4 | 1256.0 | same-strand | Domain of unknown function (DUF4944) |
2 | PF04294.15 | 0.8 | 4 | 637.5 | same-strand | VanW like protein |
3 | PF11188.10 | 0.8 | 4 | 1913.5 | opposite-strand | Protein of unknown function (DUF2975) |
4 | PF13443.8 | 0.8 | 4 | 2406.5 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
5 | PF01381.24 | 0.8 | 4 | 2406.5 | opposite-strand | Helix-turn-helix |
6 | PF05675.14 | 0.8 | 4 | 2755.0 | opposite-strand | Protein of unknown function (DUF817) |