Result : O34339
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | SPbeta prophage-derived uncharacterized protein YoqI |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2198070 |
| Right | 2198264 |
| Strand | - |
| Nucleotide Sequence | ATGATTAAATCGATTATTTTACCTGAAGAAAACACAAAAATAACTGTAGGTAAACCGATAAATGATGAATCAAATACAAAGGTAATTGCTATTTATGACTATAGAGAAGAACCAGAAGAAGCTTTCTGGGTACACTTATCAAATGGGAATGATCTATTTGTAGATAACCATGAAGTCATTGTTGAGTATGAATAG |
| Sequence | MIKSIILPEENTKITVGKPINDESNTKVIAIYDYREEPEEAFWVHLSNGNDLFVDNHEVIVEYE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O34339 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2198070 | 2198264 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2057004 | 2057198 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1964362 | 1964556 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2156162 | 2156356 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2047493 | 2047687 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF16302.7 | 0.8 | 4 | 1256.0 | same-strand | Domain of unknown function (DUF4944) |
| 2 | PF04294.15 | 0.8 | 4 | 637.5 | same-strand | VanW like protein |
| 3 | PF11188.10 | 0.8 | 4 | 1913.5 | opposite-strand | Protein of unknown function (DUF2975) |
| 4 | PF13443.8 | 0.8 | 4 | 2406.5 | opposite-strand | Cro/C1-type HTH DNA-binding domain |
| 5 | PF01381.24 | 0.8 | 4 | 2406.5 | opposite-strand | Helix-turn-helix |
| 6 | PF05675.14 | 0.8 | 4 | 2755.0 | opposite-strand | Protein of unknown function (DUF817) |
++ More..