Result : O33347
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin RelF |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 3177537 |
| Right | 3177818 |
| Strand | + |
| Nucleotide Sequence | ATGCGGATACTGCCGATTTCGACGATCAAGGGCAAGCTCAATGAGTTCGTCGACGCGGTCTCGTCGACACAGGACCAGATCACCATCACCAAGAACGGTGCACCCGCAGCCGTTCTGGTCGGCGCCGACGAGTGGGAATCGTTGCAGGAGACGCTGTACTGGCTGGCGCAACCCGGAATCAGGGAGTCGATCGCTGAAGCCGACGCCGACATTGCCTCCGGCCGCACCTACGGCGAAGACGAGATCCGCGCCGAATTCGGCGTCCCGCGACGCCCCCACTGA |
| Sequence | MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGEDEIRAEFGVPRRPH |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of toxin RelE2.; Induces its own promoter, in combination with RelG represses its own promoter. Has been seen to bind DNA in complex with toxin RelG but not alone. |
| Pubmed ID | 9634230 19114484 20011113 20498855 |
| Domain | CDD:415595 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | O33347 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3177537 | 3177818 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 3236171 | 3236452 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 368050 | 368331 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 4 | 4225041 | 4225322 | + | NZ_AP022562.1 | Mycobacterium novum |
| 5 | 2228869 | 2229150 | - | NC_015576.1 | Mycolicibacter sinensis |
| 6 | 4025178 | 4025459 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 7 | 121390 | 121671 | - | NZ_CP020810.1 | Mycobacterium dioxanotrophicus |
| 8 | 2500658 | 2500939 | - | NC_014666.1 | Frankia inefficax |
| 9 | 5399506 | 5399784 | - | NZ_CP011112.1 | Luteipulveratus mongoliensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 0.89 | 8 | 9.0 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
++ More..