Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin RelF |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 3177537 |
Right | 3177818 |
Strand | + |
Nucleotide Sequence | ATGCGGATACTGCCGATTTCGACGATCAAGGGCAAGCTCAATGAGTTCGTCGACGCGGTCTCGTCGACACAGGACCAGATCACCATCACCAAGAACGGTGCACCCGCAGCCGTTCTGGTCGGCGCCGACGAGTGGGAATCGTTGCAGGAGACGCTGTACTGGCTGGCGCAACCCGGAATCAGGGAGTCGATCGCTGAAGCCGACGCCGACATTGCCTCCGGCCGCACCTACGGCGAAGACGAGATCCGCGCCGAATTCGGCGTCCCGCGACGCCCCCACTGA |
Sequence | MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGEDEIRAEFGVPRRPH |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of toxin RelE2.; Induces its own promoter, in combination with RelG represses its own promoter. Has been seen to bind DNA in complex with toxin RelG but not alone. |
Pubmed ID | 9634230 19114484 20011113 20498855 |
Domain | CDD:415595 |
Functional Category | Antitoxin_type_2_and_DNA-binding |
Uniprot ID | O33347 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3177537 | 3177818 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 3236171 | 3236452 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 368050 | 368331 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
4 | 4225041 | 4225322 | + | NZ_AP022562.1 | Mycobacterium novum |
5 | 2228869 | 2229150 | - | NC_015576.1 | Mycolicibacter sinensis |
6 | 4025178 | 4025459 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
7 | 121390 | 121671 | - | NZ_CP020810.1 | Mycobacterium dioxanotrophicus |
8 | 2500658 | 2500939 | - | NC_014666.1 | Frankia inefficax |
9 | 5399506 | 5399784 | - | NZ_CP011112.1 | Luteipulveratus mongoliensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05016.17 | 0.89 | 8 | 9.0 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |