Result : O33084
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ESAT-6-like protein EsxB |
| NCBI Accession ID | Y14967.1 |
| Organism | Mycobacterium leprae (strain TN) |
| Left | 26986 |
| Right | 27288 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGAAATGATCACCGAGGCCGCGATCCTCACCCAGCAGGCAGCACAGTTCGATCAAATTGCGTCCGGCCTCAGCCAAGAACGGAACTTTGTTGACAGCATCGGACAGAGCTTTCAGAACACCTGGGAGGGCCAGGCCGCCTCGGCAGCCCTTGGTGCGTTGGGGCGCTTCGACGAAGCCATGCAAGACCAGATCAGACAGCTGGAAAGCATCGTCGATAAGCTGAACCGGTCCGGCGGCAACTACACCAAGACCGACGATGAAGCAAACCAATTGTTGTCCTCGAAGATGAACTTCTGA |
| Sequence | MAEMITEAAILTQQAAQFDQIASGLSQERNFVDSIGQSFQNTWEGQAASAALGALGRFDEAMQDQIRQLESIVDKLNRSGGNYTKTDDEANQLLSSKMNF |
| Source of smORF | Swiss-Prot |
| Function | A secreted protein that might play a role in virulence. Might serve as a chaperone to prevent uncontrolled membrane lysis by its partner EsxA. {ECO:0000250|UniProtKB:P9WNK5}. |
| Pubmed ID | 11234002 20085764 |
| Domain | CDD:413154 |
| Functional Category | Others |
| Uniprot ID | O33084 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 59954 | 60256 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 2 | 4192595 | 4192897 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP029543.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08817.12 | 1.0 | 2 | 2278.5 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
| 2 | PF01656.25 | 1.0 | 2 | 914.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF13614.8 | 1.0 | 2 | 914.5 | same-strand | AAA domain |
| 4 | PF06013.14 | 1.0 | 2 | 29.5 | same-strand | Proteins of 100 residues with WXG |
| 5 | PF01580.20 | 1.0 | 2 | 2294.5 | same-strand | FtsK/SpoIIIE family |
| 6 | PF05108.15 | 1.0 | 2 | 5467.5 | same-strand | Type VII secretion system ESX-1, transport TM domain B |
| 7 | PF00004.31 | 1.0 | 2 | 6916.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 8 | PF17866.3 | 1.0 | 2 | 6916.5 | same-strand | AAA lid domain |
++ More..