Result : O32620
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | COP-associated protein (Copper ion-binding protein) |
| NCBI Accession ID | AJ001932.1 |
| Organism | Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) |
| Left | 5306 |
| Right | 5506 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATAGACATTCCAGTTAAGGGCATGACCTGCCAGCATTGTGTGGATAAGATTGAAAAGTTTGTCGGAGAGTTGGAAGGGGTGAGTTATATTGGAGTGGATTTAGACAAGCAAAGCGTGCAAGTAGAATTTAGCGCGCCTGCTAGTGCAGAGGCGATTGAAGAGGCGATTTTAGACGCGGGCTATGAATTAGGCTAA |
| Sequence | MKIDIPVKGMTCQHCVDKIEKFVGELEGVSYIGVDLDKQSVQVEFSAPASAEAIEEAILDAGYELG |
| Source of smORF | Swiss-Prot |
| Function | Part of a cation-transporting system which is associated with copper export out of the H.pylori cells. |
| Pubmed ID | 9440521 |
| Domain | CDD:412222 |
| Functional Category | Metal-binding |
| Uniprot ID | O32620 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1238700 | 1238900 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 2 | 1723835 | 1724047 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 3 | 663198 | 663410 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 4 | 1351251 | 1351433 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 5 | 1027513 | 1027713 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 6 | 1885958 | 1886158 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 7 | 1893706 | 1893906 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 8 | 272992 | 273168 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 9 | 973385 | 973558 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 10 | 379020 | 379220 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 11 | 9952371 | 9952544 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014810.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00122.22 | 0.8 | 8 | 15.0 | same-strand | E1-E2 ATPase |
| 2 | PF00702.28 | 0.8 | 8 | 15.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 3 | PF00403.28 | 0.8 | 8 | 20 | same-strand | Heavy-metal-associated domain |
| 4 | PF00664.25 | 0.6 | 6 | 0.5 | same-strand | ABC transporter transmembrane region |
| 5 | PF00005.29 | 0.6 | 6 | 0.5 | same-strand | ABC transporter |
++ More..