Result : O32605
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 10 kDa chaperonin (GroES protein) (Protein Cpn10) |
| NCBI Accession ID | U88092.1 |
| Organism | Neorickettsia sennetsu (Ehrlichia sennetsu) |
| Left | 209 |
| Right | 505 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGTTGGATTAAAGATGTTACATGATCAGGTCCTTATTAGGCCTCATGAAGAAAAGGATGGTGCTGGTGGGATATATATTCCTGATTCAGCAAAGAAGAAGCCAACAATGGGTCTTGTTGTAGCTGTTGGAGCAGGTGCGAAAAACTCAAACGGCACTTTTCAGCCTGTGTGTGTCAAAGAGGGAGATATTGTTCTTTACAGAAAATGGGCAGGCAGTGAAGTGGAGCATGACGGTGTTGAGTACGTCGTGATGAAGGAGACTGATATTATTGCTATTAAGGAGGGTAAATAA |
| Sequence | MKVGLKMLHDQVLIRPHEEKDGAGGIYIPDSAKKKPTMGLVVAVGAGAKNSNGTFQPVCVKEGDIVLYRKWAGSEVEHDGVEYVVMKETDIIAIKEGK |
| Source of smORF | Swiss-Prot |
| Function | Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter. {ECO:0000255|HAMAP-Rule:MF_00580}. |
| Pubmed ID | 9215585 |
| Domain | CDD:415587 |
| Functional Category | Others |
| Uniprot ID | O32605 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 191
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 563368 | 563664 | - | NC_007798.1 | Neorickettsia sennetsu str. Miyayama |
| 2 | 563919 | 564215 | - | NZ_CP047224.1 | Neorickettsia findlayensis |
| 3 | 578087 | 578383 | - | NC_013009.1 | Neorickettsia risticii str. Illinois |
| 4 | 573554 | 573850 | - | NZ_CP007481.1 | Neorickettsia helminthoeca str. Oregon |
| 5 | 835056 | 835340 | - | NC_023063.1 | Ehrlichia muris AS145 |
| 6 | 238012 | 238296 | - | NC_021880.1 | Anaplasma phagocytophilum str. JM |
| 7 | 910541 | 910825 | - | NC_007354.1 | Ehrlichia canis str. Jake |
| 8 | 868072 | 868356 | + | NC_012026.1 | Anaplasma marginale str. Florida |
| 9 | 371345 | 371629 | - | NC_013532.1 | Anaplasma centrale str. Israel |
| 10 | 1076846 | 1077130 | - | NZ_CP040111.1 | Ehrlichia ruminantium |
| 11 | 344880 | 345164 | + | NZ_CP007480.1 | Ehrlichia chaffeensis str. West Paces |
| 12 | 1606607 | 1606888 | + | NZ_CP041636.1 | Ferrovibrio terrae |
| 13 | 843242 | 843484 | + | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 14 | 3078861 | 3079172 | - | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
| 15 | 4237585 | 4237899 | - | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 16 | 816415 | 816702 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 17 | 35400 | 35660 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 18 | 1692218 | 1692505 | - | NZ_CP060717.1 | Sphingomonas rhizophila |
| 19 | 770472 | 770777 | + | NC_020127.1 | Lawsonia intracellularis N343 |
| 20 | 2454340 | 2454597 | - | NZ_CP003182.2 | Granulibacter bethesdensis CGDNIH4 |
| 21 | 2119898 | 2120185 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 22 | 2216924 | 2217178 | - | NZ_CP041159.1 | Leisingera aquaemixtae |
| 23 | 3104885 | 3105214 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 24 | 942951 | 943211 | + | NC_003911.12 | Ruegeria pomeroyi DSS-3 |
| 25 | 1964451 | 1964696 | - | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 26 | 2194591 | 2194875 | + | NC_014217.1 | Starkeya novella DSM 506 |
| 27 | 1460457 | 1460744 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 28 | 975579 | 975839 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
| 29 | 618564 | 618839 | + | NZ_CP041046.1 | Luteibacter pinisoli |
| 30 | 4048740 | 4049024 | - | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 31 | 2561790 | 2562044 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 32 | 1757676 | 1757960 | + | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 33 | 916680 | 916931 | - | NZ_CP015093.1 | Salipiger abyssi |
| 34 | 3307159 | 3307419 | - | NZ_CP033219.1 | Parasedimentitalea marina |
| 35 | 2185269 | 2185529 | - | NZ_CP015230.1 | Epibacterium mobile F1926 |
| 36 | 3240165 | 3240446 | - | NZ_CP042434.1 | Arachidicoccus ginsenosidivorans |
| 37 | 966424 | 966684 | + | NZ_CP021047.1 | Phaeobacter gallaeciensis |
| 38 | 2783145 | 2783459 | - | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 39 | 346656 | 346934 | - | NZ_CP071057.1 | Marinicauda algicola |
| 40 | 3670353 | 3670646 | + | NZ_CP014841.1 | Dyella thiooxydans |
| 41 | 1319690 | 1319977 | - | NZ_CP053921.1 | Erythrobacter mangrovi |
| 42 | 1530290 | 1530577 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 43 | 3052774 | 3053061 | - | NZ_CP061205.1 | Kordiimonas pumila |
| 44 | 204703 | 204990 | + | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 45 | 388321 | 388596 | + | NC_020541.1 | Rhodanobacter denitrificans |
| 46 | 1973838 | 1974092 | - | NZ_CP009571.1 | Sphingomonas taxi |
| 47 | 975816 | 976109 | - | NZ_CP017480.1 | Luteibacter rhizovicinus DSM 16549 |
| 48 | 280908 | 281168 | - | NZ_CP025613.1 | Niveispirillum cyanobacteriorum |
| 49 | 1455684 | 1455980 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 50 | 3167903 | 3168178 | - | NC_017033.1 | Frateuria aurantia DSM 6220 |
| 51 | 3608400 | 3608681 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 52 | 360285 | 360572 | + | NC_016929.1 | Rickettsia canadensis str. CA410 |
| 53 | 2427411 | 2427671 | - | NZ_CP016364.1 | Phaeobacter porticola |
| 54 | 2480155 | 2480415 | - | NZ_CP010650.1 | Phaeobacter inhibens |
| 55 | 1884943 | 1885203 | + | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 56 | 812265 | 812513 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
| 57 | 736565 | 736825 | - | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 58 | 891988 | 892275 | - | NC_009881.1 | Rickettsia akari str. Hartford |
| 59 | 2494437 | 2494724 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 60 | 2687783 | 2688076 | - | NZ_AP018560.1 | Aerosticca soli |
| 61 | 950841 | 951095 | + | NC_023135.1 | Leisingera methylohalidivorans DSM 14336 |
| 62 | 440737 | 441054 | + | NZ_AP019700.1 | Stella humosa |
| 63 | 2268399 | 2268686 | - | NZ_CP060718.1 | Sphingomonas lutea |
| 64 | 2884894 | 2885157 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 65 | 529697 | 529984 | + | NC_017058.1 | Rickettsia australis str. Cutlack |
| 66 | 703106 | 703393 | + | NZ_LN794217.1 | Rickettsia monacensis |
| 67 | 797790 | 798077 | - | NC_017049.1 | Rickettsia prowazekii str. Chernikova |
| 68 | 5916725 | 5917012 | + | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 69 | 3638952 | 3639197 | + | NZ_CP071517.1 | Lysobacter arenosi |
| 70 | 2760564 | 2760818 | - | NZ_CP022110.1 | Nitrospirillum amazonense CBAmc |
| 71 | 985402 | 985683 | + | NZ_CP011390.1 | Flavisolibacter tropicus |
| 72 | 1171715 | 1172026 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 73 | 3715708 | 3715995 | - | NZ_CP004393.1 | Celeribacter indicus |
| 74 | 134206 | 134478 | + | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
| 75 | 808125 | 808412 | - | NC_017066.1 | Rickettsia typhi str. TH1527 |
| 76 | 3440947 | 3441210 | - | NZ_CP039690.1 | Phreatobacter stygius |
| 77 | 3134708 | 3134968 | - | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 78 | 3335440 | 3335751 | - | NZ_CP065915.1 | Pelagovum pacificum |
| 79 | 3110568 | 3110849 | - | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 80 | 3703863 | 3704123 | + | NC_009511.1 | Sphingomonas wittichii RW1 |
| 81 | 1000712 | 1000972 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 82 | 2993809 | 2994069 | - | NZ_CP048788.1 | Roseobacter ponti |
| 83 | 464759 | 465019 | - | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 84 | 4501085 | 4501327 | + | NZ_AP017422.1 | Filimonas lacunae |
| 85 | 89936 | 90241 | + | NZ_CP011450.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 86 | 206003 | 206275 | - | NZ_AP017656.1 | Sphingobium cloacae |
| 87 | 1853759 | 1854016 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
| 88 | 2397457 | 2397756 | + | NZ_CP045423.1 | Microvirga thermotolerans |
| 89 | 214321 | 214608 | + | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 90 | 275275 | 275562 | - | NZ_CP053015.1 | Sphingomonas lacunae |
| 91 | 120085 | 120372 | + | NZ_AP019389.1 | Qipengyuania flava |
| 92 | 3098161 | 3098448 | - | NC_015186.1 | Acidiphilium multivorum AIU301 |
| 93 | 2270082 | 2270357 | + | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 94 | 705870 | 706157 | - | NZ_CP041659.1 | Sphingomonas xanthus |
| 95 | 626176 | 626430 | + | NZ_CP012160.1 | Octadecabacter temperatus |
| 96 | 2766950 | 2767210 | + | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 97 | 2243863 | 2244165 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 98 | 4167822 | 4168070 | - | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 99 | 213854 | 214141 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 100 | 3902740 | 3902994 | - | NZ_CP014327.1 | Halocynthiibacter arcticus |
| 101 | 1324374 | 1324670 | - | NC_020300.1 | Bartonella australis Aust/NH1 |
| 102 | 229244 | 229504 | - | NC_007626.1 | Magnetospirillum magneticum AMB-1 |
| 103 | 976822 | 977109 | - | NZ_AP019563.1 | Rickettsia asiatica |
| 104 | 195800 | 196096 | - | NZ_CP010401.1 | Bartonella ancashensis |
| 105 | 2642461 | 2642748 | - | NZ_CP024199.1 | Thalassospira marina |
| 106 | 1480753 | 1481046 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 107 | 734742 | 735035 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 108 | 2047848 | 2048141 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 109 | 1072062 | 1072319 | + | NZ_CP023406.1 | Luteimonas chenhongjianii |
| 110 | 170650 | 170937 | + | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 111 | 653196 | 653483 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 112 | 2654436 | 2654726 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 113 | 4121335 | 4121595 | + | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 114 | 1676321 | 1676566 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 115 | 450167 | 450427 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 116 | 1909196 | 1909483 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 117 | 3576490 | 3576744 | - | NC_016609.1 | Niastella koreensis GR20-10 |
| 118 | 419138 | 419431 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 119 | 2836669 | 2836956 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 120 | 2565739 | 2566029 | + | NC_008789.1 | Halorhodospira halophila SL1 |
| 121 | 2625539 | 2625787 | - | NZ_CP038254.1 | Legionella israelensis |
| 122 | 1774870 | 1775127 | + | NZ_CP038141.1 | Swingsia samuiensis |
| 123 | 2296287 | 2296544 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 124 | 819049 | 819306 | + | NZ_CP014689.1 | Gluconobacter albidus |
| 125 | 2653810 | 2654067 | - | NZ_CP032125.1 | Profundibacter amoris |
| 126 | 3234782 | 3235030 | + | NZ_LR134374.1 | Legionella spiritensis |
| 127 | 3897132 | 3897386 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 128 | 2141458 | 2141745 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
| 129 | 2152788 | 2153045 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
| 130 | 2489876 | 2490130 | - | NZ_CP022957.1 | Maribacter cobaltidurans |
| 131 | 1845728 | 1845985 | - | NC_020908.1 | Octadecabacter arcticus 238 |
| 132 | 2300724 | 2300981 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 133 | 2291754 | 2292014 | + | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 134 | 2809424 | 2809663 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 135 | 2126657 | 2126929 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 136 | 2276385 | 2276645 | + | NZ_CP060092.1 | Teredinibacter purpureus |
| 137 | 931579 | 931818 | + | NC_015945.1 | Muricauda ruestringensis DSM 13258 |
| 138 | 2494195 | 2494482 | + | NZ_CP040818.1 | Paraoceanicella profunda |
| 139 | 3710364 | 3710651 | - | NZ_CP040818.1 | Paraoceanicella profunda |
| 140 | 1863921 | 1864208 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 141 | 1386869 | 1387123 | + | NC_015844.1 | Zobellia galactanivorans |
| 142 | 1979413 | 1979655 | + | NZ_CP020104.1 | Spirosoma aerolatum |
| 143 | 3433626 | 3433886 | + | NZ_LR593887.1 | Tuwongella immobilis |
| 144 | 3465315 | 3465602 | - | NZ_CP029843.1 | Lysobacter maris |
| 145 | 3610458 | 3610745 | - | NZ_CP046603.1 | Lysobacter soli |
| 146 | 3609200 | 3609454 | + | NZ_CP060436.1 | Pseudooceanicola algae |
| 147 | 1124704 | 1124958 | - | NZ_CP022387.1 | Capnocytophaga stomatis |
| 148 | 1096750 | 1097028 | + | NZ_CP030104.1 | Flagellimonas maritima |
| 149 | 1873707 | 1873952 | - | NZ_CP019437.1 | Thioclava nitratireducens |
| 150 | 1673453 | 1673698 | - | NZ_CP053562.1 | Thioclava electrotropha |
| 151 | 3159709 | 3159951 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 152 | 764465 | 764707 | - | NZ_CP014263.1 | Spirosoma montaniterrae |
| 153 | 4507013 | 4507255 | + | NZ_CP010429.1 | Spirosoma radiotolerans |
| 154 | 5853122 | 5853364 | + | NZ_CP050063.1 | Spirosoma aureum |
| 155 | 1304889 | 1305128 | + | NZ_LT906449.1 | Capnocytophaga haemolytica |
| 156 | 825386 | 825661 | + | NC_018013.1 | Aequorivita sublithincola DSM 14238 |
| 157 | 878204 | 878452 | + | NZ_CP016397.1 | Legionella clemsonensis |
| 158 | 3097032 | 3097271 | - | NZ_CP017478.1 | Urechidicola croceus |
| 159 | 24517 | 24804 | - | NC_008340.1 | Alkalilimnicola ehrlichii MLHE-1 |
| 160 | 5602214 | 5602456 | + | NC_015703.1 | Runella slithyformis DSM 19594 |
| 161 | 4152960 | 4153214 | + | NZ_CP032050.1 | Euzebyella marina |
| 162 | 523476 | 523718 | + | NZ_CP025096.1 | Spirosoma pollinicola |
| 163 | 594786 | 595043 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 164 | 538513 | 538800 | + | NZ_CP041242.1 | Lysobacter alkalisoli |
| 165 | 591633 | 591914 | + | NZ_CP027860.1 | Ahniella affigens |
| 166 | 24332 | 24577 | + | NZ_CP032132.1 | Acinetobacter chinensis |
| 167 | 37190 | 37435 | + | NZ_CP035935.1 | Acinetobacter cumulans |
| 168 | 10515 | 10760 | + | NZ_CP029737.1 | Providencia rettgeri |
| 169 | 110365 | 110610 | + | NZ_CP048797.1 | Providencia vermicola |
| 170 | 2531731 | 2531976 | - | NZ_CP029397.2 | Acinetobacter defluvii |
| 171 | 1005370 | 1005624 | + | NZ_CP011071.1 | Muricauda lutaonensis |
| 172 | 3036501 | 3036767 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 173 | 206325 | 206582 | + | NZ_CP024955.1 | Kyrpidia spormannii |
| 174 | 210618 | 210875 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 175 | 574741 | 574983 | + | NZ_CP009976.1 | Cellulophaga baltica 18 |
| 176 | 1348689 | 1348964 | + | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 177 | 1711754 | 1712029 | - | NZ_CP017479.1 | Flavobacterium gilvum |
| 178 | 5013513 | 5013767 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 179 | 1024419 | 1024661 | + | NC_014934.1 | Cellulophaga algicola DSM 14237 |
| 180 | 1079205 | 1079492 | - | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 181 | 642704 | 642985 | + | NZ_CP007035.1 | Niabella soli DSM 19437 |
| 182 | 1915823 | 1916083 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
| 183 | 1251913 | 1252191 | - | NC_013222.1 | Robiginitalea biformata HTCC2501 |
| 184 | 2877086 | 2877328 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 185 | 1447779 | 1448039 | + | NC_016112.1 | Methylotuvimicrobium alcaliphilum 20Z |
| 186 | 3289788 | 3290036 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 187 | 21235 | 21489 | - | NZ_CP043611.1 | Paenibacillus antarcticus |
| 188 | 1443926 | 1444186 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 189 | 2404403 | 2404657 | - | NZ_CP035492.1 | Paenibacillus protaetiae |
| 190 | 1413069 | 1413311 | - | NZ_CP060711.1 | Thermomonas brevis |
| 191 | 511370 | 511645 | - | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 192 | 821999 | 822283 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 193 | 672332 | 672616 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 194 | 1335358 | 1335642 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 195 | 1512257 | 1512541 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 196 | 1157079 | 1157336 | + | NZ_CP046037.1 | Latilactobacillus sakei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007798.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00118.26 | 0.99 | 189 | 56.0 | same-strand | TCP-1/cpn60 chaperonin family |
++ More..