Result : O32528
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized lipoprotein YpdI |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 2494698 |
| Right | 2494973 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGTAAACTTAATACTTTTCAGCTTATTTTTATTGGTCTCTATTATGGCATGCAATGTTTTTGCATTTTCCATTTCGGGTGGTGGAAGTGAGAGGAGCTATAAAGAGACTGAAAAAACATCAGCGATGACGACCACACACTCTACAAAACTTCAGCCATCACAGGCGATTTTGTTTAAGATGAGAGAAGATGCGCCACCATTAAACCTCACAGAAGAAATGCCGCCCCCTTTTCCGACAAAGGCGAATTATCTTATTCATCCTGTGCGATAG |
| Sequence | MKVNLILFSLFLLVSIMACNVFAFSISGGGSERSYKETEKTSAMTTTHSTKLQPSQAILFKMREDAPPLNLTEEMPPPFPTKANYLIHPVR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32528 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2494698 | 2494973 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2497749 | 2498024 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3222965 | 3223240 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1235631 | 1235906 | - | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02515.19 | 1.0 | 3 | 1444 | opposite-strand | CoA-transferase family III |
| 2 | PF02776.20 | 1.0 | 3 | 2746.0 | opposite-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| 3 | PF00205.24 | 1.0 | 3 | 2746.0 | opposite-strand | Thiamine pyrophosphate enzyme, central domain |
| 4 | PF02775.23 | 1.0 | 3 | 2746.0 | opposite-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 5 | PF10938.10 | 1.0 | 3 | 296.0 | opposite-strand | YfdX protein |
| 6 | PF10810.10 | 1.0 | 3 | 77.0 | opposite-strand | Protein of unknown function (DUF2545) |
| 7 | PF03279.15 | 1.0 | 3 | 672.0 | same-strand | Bacterial lipid A biosynthesis acyltransferase |
| 8 | PF00155.23 | 1.0 | 3 | 2084.0 | opposite-strand | Aminotransferase class I and II |
| 9 | PF07694.14 | 0.67 | 2 | 3699 | same-strand | 5TMR of 5TMR-LYT |
| 10 | PF06580.15 | 1.0 | 3 | 3699.5 | same-strand | Histidine kinase |
| 11 | PF02518.28 | 1.0 | 3 | 3699.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 12 | PF01590.28 | 1.0 | 3 | 3699.5 | same-strand | GAF domain |
| 13 | PF04397.17 | 0.67 | 2 | 5410 | same-strand | LytTr DNA-binding domain |
| 14 | PF00072.26 | 1.0 | 3 | 5410.5 | same-strand | Response regulator receiver domain |
++ More..