Result : O32437
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ComG operon repressor |
| NCBI Accession ID | D86376.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3893 |
| Right | 4084 |
| Strand | + |
| Nucleotide Sequence | ATGCAGCAAGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATCAGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTGGCAAGTCTGACGCTAAATCTGAAACAGAATAA |
| Sequence | MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE |
| Source of smORF | Swiss-Prot |
| Function | Negatively regulates the transcription of the comG operon. {ECO:0000269|Pubmed:10940045}. |
| Pubmed ID | 9335269 9384377 10940045 |
| Domain | CDD:313911 |
| Functional Category | Others |
| Uniprot ID | O32437 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 37
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1211375 | 1211566 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 2 | 1176738 | 1176929 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1185749 | 1185940 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1207597 | 1207788 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 5 | 1371103 | 1371294 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 782027 | 782218 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1133930 | 1134121 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2837517 | 2837708 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1107687 | 1107878 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1286654 | 1286842 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1106367 | 1106564 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 391134 | 391331 | - | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1230272 | 1230433 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1324903 | 1325064 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 519901 | 520098 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 432219 | 432410 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 17 | 2845190 | 2845375 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 18 | 108499 | 108663 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 19 | 1367165 | 1367326 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 20 | 3137285 | 3137440 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 21 | 1725064 | 1725228 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 22 | 932866 | 933051 | + | NZ_CP012024.1 | Bacillus smithii |
| 23 | 676360 | 676518 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 24 | 1291650 | 1291832 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 25 | 1308564 | 1308746 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 26 | 3862619 | 3862801 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 27 | 1850825 | 1851007 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 28 | 1128968 | 1129129 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 29 | 3938418 | 3938579 | - | NZ_CP040336.1 | Bacillus luti |
| 30 | 1162951 | 1163112 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 31 | 1146603 | 1146764 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 32 | 928758 | 928913 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 33 | 998065 | 998223 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 34 | 3003806 | 3003964 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 35 | 1193151 | 1193312 | + | NC_011725.1 | Bacillus cereus B4264 |
| 36 | 1448264 | 1448440 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 37 | 2679697 | 2679861 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11151.10 | 0.95 | 35 | 2684 | opposite-strand | Protein of unknown function (DUF2929) |
| 2 | PF02608.16 | 0.65 | 24 | 15.0 | same-strand | ABC transporter substrate-binding protein PnrA-like |
| 3 | PF08541.12 | 1.0 | 37 | 464 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 4 | PF08545.12 | 1.0 | 37 | 464 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 5 | PF00109.28 | 0.97 | 36 | 1419.5 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 6 | PF02801.24 | 0.97 | 36 | 1419.5 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 7 | PF10026.11 | 0.84 | 31 | 2705 | same-strand | Predicted Zn-dependent protease (DUF2268) |
++ More..