Result : O32302
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Anti-adapter protein SpxO |
| NCBI Accession ID | Z93941.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1799 |
| Right | 1963 |
| Strand | + |
| Nucleotide Sequence | ATGAGAGAATTGGACGAAATGATCAGCCGCTTGCGAAACAGAGGAATCAAAGTGGAGAAAGTCAAATATCCGAAGCAGACCTTGTCAGAGAAAAAATGGGTTCATCAATGCAAACAGCCGCTCAAAACAAATTACAGAGATTTTAACGGCTATTCTTTCACATAA |
| Sequence | MRELDEMISRLRNRGIKVEKVKYPKQTLSEKKWVHQCKQPLKTNYRDFNGYSFT |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of Spx proteolytic control. Acts by interacting with SpxH/YjbH, which disrups interaction between SpxH and Spx, and inhibits SpxH-enhanced proteolysis of Spx by ClpXP (Pubmed:21378193). Required for the stabilization of Spx and activation of Spx-regulated genes in response to cell wall stress (Pubmed:30001325). {ECO:0000269|Pubmed:21378193, ECO:0000269|Pubmed:30001325}. |
| Pubmed ID | 9353931 9384377 21378193 30001325 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32302 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3387781 | 3387945 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2869288 | 2869452 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 3 | 3255084 | 3255248 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3195960 | 3196124 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3172530 | 3172694 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3247504 | 3247668 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 3200766 | 3200930 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 797008 | 797172 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3219619 | 3219783 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3739826 | 3739990 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2329730 | 2329894 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 3550136 | 3550300 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3325673 | 3325837 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 2979581 | 2979745 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 2429445 | 2429609 | + | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00106.27 | 0.87 | 13 | 4292 | opposite-strand | short chain dehydrogenase |
| 2 | PF08659.12 | 0.87 | 13 | 4292 | opposite-strand | KR domain |
| 3 | PF00210.26 | 0.67 | 10 | 3752.0 | opposite-strand | Ferritin-like domain |
| 4 | PF13365.8 | 1.0 | 15 | 2335 | same-strand | Trypsin-like peptidase domain |
| 5 | PF13180.8 | 1.0 | 15 | 2335 | same-strand | PDZ domain |
| 6 | PF00089.28 | 1.0 | 15 | 2335 | same-strand | Trypsin |
| 7 | PF00072.26 | 1.0 | 15 | 1380 | opposite-strand | Response regulator receiver domain |
| 8 | PF00486.30 | 1.0 | 15 | 1380 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 9 | PF02518.28 | 1.0 | 15 | 28 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 10 | PF00672.27 | 1.0 | 15 | 28 | opposite-strand | HAMP domain |
| 11 | PF00512.27 | 1.0 | 15 | 28 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 12 | PF14501.8 | 1.0 | 15 | 28 | opposite-strand | GHKL domain |
| 13 | PF00440.25 | 1.0 | 15 | 169 | opposite-strand | Bacterial regulatory proteins, tetR family |
| 14 | PF00206.22 | 1.0 | 15 | 1090 | same-strand | Lyase |
| 15 | PF10415.11 | 1.0 | 15 | 1090 | same-strand | Fumarase C C-terminus |
| 16 | PF13113.8 | 1.0 | 15 | 2546 | same-strand | Protein of unknown function (DUF3970) |
| 17 | PF03323.15 | 1.0 | 15 | 2848 | opposite-strand | Bacillus/Clostridium GerA spore germination protein |
| 18 | PF03845.15 | 0.93 | 14 | 4263.5 | opposite-strand | Spore germination protein |
++ More..