Protein Information |
Information Type | Description |
---|---|
Protein name | Anti-adapter protein SpxO |
NCBI Accession ID | Z93941.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 1799 |
Right | 1963 |
Strand | + |
Nucleotide Sequence | ATGAGAGAATTGGACGAAATGATCAGCCGCTTGCGAAACAGAGGAATCAAAGTGGAGAAAGTCAAATATCCGAAGCAGACCTTGTCAGAGAAAAAATGGGTTCATCAATGCAAACAGCCGCTCAAAACAAATTACAGAGATTTTAACGGCTATTCTTTCACATAA |
Sequence | MRELDEMISRLRNRGIKVEKVKYPKQTLSEKKWVHQCKQPLKTNYRDFNGYSFT |
Source of smORF | Swiss-Prot |
Function | Inhibitor of Spx proteolytic control. Acts by interacting with SpxH/YjbH, which disrups interaction between SpxH and Spx, and inhibits SpxH-enhanced proteolysis of Spx by ClpXP (Pubmed:21378193). Required for the stabilization of Spx and activation of Spx-regulated genes in response to cell wall stress (Pubmed:30001325). {ECO:0000269|Pubmed:21378193, ECO:0000269|Pubmed:30001325}. |
Pubmed ID | 9353931 9384377 21378193 30001325 |
Domain | |
Functional Category | Others |
Uniprot ID | O32302 |
ORF Length (Amino Acid) | 54 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3387781 | 3387945 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2869288 | 2869452 | + | NZ_CP029364.1 | Bacillus halotolerans |
3 | 3255084 | 3255248 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 3195960 | 3196124 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
5 | 3172530 | 3172694 | - | NZ_CP051464.1 | Bacillus mojavensis |
6 | 3247504 | 3247668 | - | NZ_CP033052.1 | Bacillus vallismortis |
7 | 3200766 | 3200930 | - | NZ_CP048852.1 | Bacillus tequilensis |
8 | 797008 | 797172 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 3219619 | 3219783 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 3739826 | 3739990 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 2329730 | 2329894 | + | NZ_CP043404.1 | Bacillus safensis |
12 | 3550136 | 3550300 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 3325673 | 3325837 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
14 | 2979581 | 2979745 | - | NZ_CP011150.1 | Bacillus altitudinis |
15 | 2429445 | 2429609 | + | NZ_CP017786.1 | Bacillus xiamenensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00106.27 | 0.87 | 13 | 4292 | opposite-strand | short chain dehydrogenase |
2 | PF08659.12 | 0.87 | 13 | 4292 | opposite-strand | KR domain |
3 | PF00210.26 | 0.67 | 10 | 3752.0 | opposite-strand | Ferritin-like domain |
4 | PF13365.8 | 1.0 | 15 | 2335 | same-strand | Trypsin-like peptidase domain |
5 | PF13180.8 | 1.0 | 15 | 2335 | same-strand | PDZ domain |
6 | PF00089.28 | 1.0 | 15 | 2335 | same-strand | Trypsin |
7 | PF00072.26 | 1.0 | 15 | 1380 | opposite-strand | Response regulator receiver domain |
8 | PF00486.30 | 1.0 | 15 | 1380 | opposite-strand | Transcriptional regulatory protein, C terminal |
9 | PF02518.28 | 1.0 | 15 | 28 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
10 | PF00672.27 | 1.0 | 15 | 28 | opposite-strand | HAMP domain |
11 | PF00512.27 | 1.0 | 15 | 28 | opposite-strand | His Kinase A (phospho-acceptor) domain |
12 | PF14501.8 | 1.0 | 15 | 28 | opposite-strand | GHKL domain |
13 | PF00440.25 | 1.0 | 15 | 169 | opposite-strand | Bacterial regulatory proteins, tetR family |
14 | PF00206.22 | 1.0 | 15 | 1090 | same-strand | Lyase |
15 | PF10415.11 | 1.0 | 15 | 1090 | same-strand | Fumarase C C-terminus |
16 | PF13113.8 | 1.0 | 15 | 2546 | same-strand | Protein of unknown function (DUF3970) |
17 | PF03323.15 | 1.0 | 15 | 2848 | opposite-strand | Bacillus/Clostridium GerA spore germination protein |
18 | PF03845.15 | 0.93 | 14 | 4263.5 | opposite-strand | Spore germination protein |