Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YyzB |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 4159253 |
Right | 4159456 |
Strand | - |
Nucleotide Sequence | ATGCACGCACCGTTATCCTTATTAAAACAAATGCTGAAGGAACACCAAATAGACACTGAAAAAGCTGTCACTTTCGAAGAATATATAGCAATGAGGTTAAAGCTTCAGGAGCTGATGGGGAAATTTGCTTCGATCGGGGAGTGGGATCTGTATCAAAAAGCGGCAGATTTGATGATGCACATAGGCATCCAATGGATGAAATAA |
Sequence | MHAPLSLLKQMLKEHQIDTEKAVTFEEYIAMRLKLQELMGKFASIGEWDLYQKAADLMMHIGIQWMK |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O32296 |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4159253 | 4159456 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3999215 | 3999418 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 4061925 | 4062128 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 2083724 | 2083927 | + | NZ_CP029364.1 | Bacillus halotolerans |
5 | 3955951 | 3956154 | - | NZ_CP048852.1 | Bacillus tequilensis |
6 | 3971104 | 3971307 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 85199 | 85396 | - | NZ_CP033052.1 | Bacillus vallismortis |
8 | 4372928 | 4373146 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
9 | 4576723 | 4576941 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00072.26 | 0.78 | 7 | 4842 | same-strand | Response regulator receiver domain |
2 | PF00486.30 | 0.78 | 7 | 4842 | same-strand | Transcriptional regulatory protein, C terminal |
3 | PF00709.23 | 1.0 | 9 | 2523 | same-strand | Adenylosuccinate synthetase |
4 | PF00903.27 | 0.78 | 7 | 1899 | same-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
5 | PF03796.17 | 1.0 | 9 | 417 | same-strand | DnaB-like helicase C terminal domain |
6 | PF00772.23 | 1.0 | 9 | 417 | same-strand | DnaB-like helicase N terminal domain |
7 | PF13481.8 | 1.0 | 9 | 417 | same-strand | AAA domain |
8 | PF09954.11 | 0.89 | 8 | 48.0 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2188) |
9 | PF14174.8 | 0.89 | 8 | 121.0 | opposite-strand | YycC-like protein |
10 | PF03948.16 | 0.78 | 7 | 3741 | same-strand | Ribosomal protein L9, C-terminal domain |
11 | PF01281.21 | 0.78 | 7 | 3741 | same-strand | Ribosomal protein L9, N-terminal domain |
12 | PF01368.22 | 0.78 | 7 | 4187 | same-strand | DHH family |
13 | PF02272.21 | 0.78 | 7 | 4187 | same-strand | DHHA1 domain |