Result : O32295
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Phosphatase RapG inhibitor (Phosphatase regulator G) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4141358 |
| Right | 4141474 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAGATTTCTGATTGGCGCAGGCGTCGCAGCGGTGATTTTATCAGGTTGGTTTATTGCGGACCATCAAACCCACTCACAGGAAATGAAAGTCGCTGAGAAAATGATTGGATAA |
| Sequence | MKRFLIGAGVAAVILSGWFIADHQTHSQEMKVAEKMIG |
| Source of smORF | Swiss-Prot |
| Function | Inhibitor of the activity of phosphatase RapG. |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32295 |
| ORF Length (Amino Acid) | 38 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4141358 | 4141474 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3981564 | 3981680 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 4040605 | 4040721 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2101556 | 2101672 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3953686 | 3953802 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3938234 | 3938350 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 67583 | 67699 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 1235852 | 1235968 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 9 | 1142577 | 1142693 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18801.3 | 1.0 | 9 | 1 | same-strand | response regulator aspartate phosphatase H, N terminal |
| 2 | PF13424.8 | 1.0 | 9 | 1 | same-strand | Tetratricopeptide repeat |
| 3 | PF00491.23 | 0.78 | 7 | 39 | opposite-strand | Arginase family |
| 4 | PF00324.23 | 0.78 | 7 | 1003 | opposite-strand | Amino acid permease |
| 5 | PF13520.8 | 0.78 | 7 | 1003 | opposite-strand | Amino acid permease |
| 6 | PF00202.23 | 0.78 | 7 | 2630 | opposite-strand | Aminotransferase class-III |
| 7 | PF00158.28 | 0.78 | 7 | 4076 | same-strand | Sigma-54 interaction domain |
| 8 | PF14532.8 | 0.78 | 7 | 4076 | same-strand | Sigma-54 interaction domain |
| 9 | PF02954.21 | 0.78 | 7 | 4076 | same-strand | Bacterial regulatory protein, Fis family |
| 10 | PF13426.9 | 0.78 | 7 | 4076 | same-strand | PAS domain |
| 11 | PF07728.16 | 0.78 | 7 | 4076 | same-strand | AAA domain (dynein-related subfamily) |
| 12 | PF08448.12 | 0.78 | 7 | 4076 | same-strand | PAS fold |
| 13 | PF07726.13 | 0.78 | 7 | 4076 | same-strand | ATPase family associated with various cellular activities (AAA) |
++ More..