Result : O32292
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative phosphotransferase enzyme IIA component YyzE (PTS system EIIA component) |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 4122619 |
| Right | 4122849 |
| Strand | - |
| Nucleotide Sequence | ATGGTTACGCCTACAAAGCATGCGATTGGCCTGCGTTCAGCGTCCGGCGTCGAATTGCTTGCGCACATCGGGCTGGATACGGTGACATTTGACGGCACGCCTTTTTCCTTGAAGGTAAAAGAAGGCGATACCGTCAAAAAAGGCGAAGTGCTTGTTGAGTTTGATAAAGCTTTCATTGAAGACATTGAGGAAAGTGCATTACATCAAAAAATATTTACAGTCGTAAGCTGA |
| Sequence | MVTPTKHAIGLRSASGVELLAHIGLDTVTFDGTPFSLKVKEGDTVKKGEVLVEFDKAFIEDIEESALHQKIFTVVS |
| Source of smORF | Swiss-Prot |
| Function | The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. {ECO:0000250}. |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32292 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4122619 | 4122849 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1763356 | 1763562 | + | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07702.15 | 1.0 | 2 | 1506.5 | opposite-strand | UTRA domain |
| 2 | PF00392.23 | 1.0 | 2 | 1506.5 | opposite-strand | Bacterial regulatory proteins, gntR family |
++ More..