Protein Information |
Information Type | Description |
---|---|
Protein name | Putative phosphotransferase enzyme IIA component YyzE (PTS system EIIA component) |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 4122619 |
Right | 4122849 |
Strand | - |
Nucleotide Sequence | ATGGTTACGCCTACAAAGCATGCGATTGGCCTGCGTTCAGCGTCCGGCGTCGAATTGCTTGCGCACATCGGGCTGGATACGGTGACATTTGACGGCACGCCTTTTTCCTTGAAGGTAAAAGAAGGCGATACCGTCAAAAAAGGCGAAGTGCTTGTTGAGTTTGATAAAGCTTTCATTGAAGACATTGAGGAAAGTGCATTACATCAAAAAATATTTACAGTCGTAAGCTGA |
Sequence | MVTPTKHAIGLRSASGVELLAHIGLDTVTFDGTPFSLKVKEGDTVKKGEVLVEFDKAFIEDIEESALHQKIFTVVS |
Source of smORF | Swiss-Prot |
Function | The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. {ECO:0000250}. |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O32292 |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4122619 | 4122849 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1763356 | 1763562 | + | NZ_CP029364.1 | Bacillus halotolerans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07702.15 | 1.0 | 2 | 1506.5 | opposite-strand | UTRA domain |
2 | PF00392.23 | 1.0 | 2 | 1506.5 | opposite-strand | Bacterial regulatory proteins, gntR family |