Result : O32283
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YxzF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3964091 |
| Right | 3964249 |
| Strand | - |
| Nucleotide Sequence | ATGGTTGAGAAAAAAGAAGGGAGAATCGGAGCTTTGAAAAAGATGATCAAAACCGTTATCAAATGGGCGCCGGTCATTTACCCGATTGTTCGAAAAATCATGAAGGACCGCAAGGCGTCTAAACAAAAGAATATGTCCGCATCTAGAACAGCCGGCTGA |
| Sequence | MVEKKEGRIGALKKMIKTVIKWAPVIYPIVRKIMKDRKASKQKNMSASRTAG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | O32283 |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3964091 | 3964249 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3851779 | 3851937 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 2272526 | 2272684 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 3786521 | 3786679 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3779068 | 3779223 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3846715 | 3846873 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1861036 | 1861188 | + | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02056.18 | 1.0 | 7 | 4249 | same-strand | Family 4 glycosyl hydrolase |
| 2 | PF11975.10 | 1.0 | 7 | 4249 | same-strand | Family 4 glycosyl hydrolase C-terminal domain |
| 3 | PF02255.18 | 1.0 | 7 | 3987 | same-strand | PTS system, Lactose/Cellobiose specific IIA subunit |
| 4 | PF02378.20 | 1.0 | 7 | 2544 | same-strand | Phosphotransferase system, EIIC |
| 5 | PF02302.19 | 1.0 | 7 | 2217 | same-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
| 6 | PF00874.22 | 1.0 | 7 | 167 | same-strand | PRD domain |
| 7 | PF00359.24 | 1.0 | 7 | 167 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 8 | PF08279.14 | 1.0 | 7 | 167 | same-strand | HTH domain |
| 9 | PF05043.15 | 1.0 | 7 | 167 | same-strand | Mga helix-turn-helix domain |
| 10 | PF02245.18 | 0.86 | 6 | 29.0 | same-strand | Methylpurine-DNA glycosylase (MPG) |
| 11 | PF00199.21 | 0.86 | 6 | 747.5 | opposite-strand | Catalase |
| 12 | PF06628.14 | 0.86 | 6 | 747.5 | opposite-strand | Catalase-related immune-responsive |
++ More..