Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YxzF |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 3964091 |
Right | 3964249 |
Strand | - |
Nucleotide Sequence | ATGGTTGAGAAAAAAGAAGGGAGAATCGGAGCTTTGAAAAAGATGATCAAAACCGTTATCAAATGGGCGCCGGTCATTTACCCGATTGTTCGAAAAATCATGAAGGACCGCAAGGCGTCTAAACAAAAGAATATGTCCGCATCTAGAACAGCCGGCTGA |
Sequence | MVEKKEGRIGALKKMIKTVIKWAPVIYPIVRKIMKDRKASKQKNMSASRTAG |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | O32283 |
ORF Length (Amino Acid) | 52 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3964091 | 3964249 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3851779 | 3851937 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 2272526 | 2272684 | + | NZ_CP029364.1 | Bacillus halotolerans |
4 | 3786521 | 3786679 | - | NZ_CP048852.1 | Bacillus tequilensis |
5 | 3779068 | 3779223 | - | NZ_CP051464.1 | Bacillus mojavensis |
6 | 3846715 | 3846873 | - | NZ_CP033052.1 | Bacillus vallismortis |
7 | 1861036 | 1861188 | + | NZ_CP017786.1 | Bacillus xiamenensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02056.18 | 1.0 | 7 | 4249 | same-strand | Family 4 glycosyl hydrolase |
2 | PF11975.10 | 1.0 | 7 | 4249 | same-strand | Family 4 glycosyl hydrolase C-terminal domain |
3 | PF02255.18 | 1.0 | 7 | 3987 | same-strand | PTS system, Lactose/Cellobiose specific IIA subunit |
4 | PF02378.20 | 1.0 | 7 | 2544 | same-strand | Phosphotransferase system, EIIC |
5 | PF02302.19 | 1.0 | 7 | 2217 | same-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
6 | PF00874.22 | 1.0 | 7 | 167 | same-strand | PRD domain |
7 | PF00359.24 | 1.0 | 7 | 167 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
8 | PF08279.14 | 1.0 | 7 | 167 | same-strand | HTH domain |
9 | PF05043.15 | 1.0 | 7 | 167 | same-strand | Mga helix-turn-helix domain |
10 | PF02245.18 | 0.86 | 6 | 29.0 | same-strand | Methylpurine-DNA glycosylase (MPG) |
11 | PF00199.21 | 0.86 | 6 | 747.5 | opposite-strand | Catalase |
12 | PF06628.14 | 0.86 | 6 | 747.5 | opposite-strand | Catalase-related immune-responsive |